Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Ureaplasma urealyticum Search Results

Record: 1 of 1  
MiniMap IGR112 IGR108 IGR111 IGR109 IGR110 UU127 atpE, - UU128 UU131 atpG, - UU130 UU125 atpB, - UU129 atpA, - UU132 UU126 UU127 atpE, - UU128 UU131 atpG, - UU130 UU125 atpB, - UU129 atpA, - UU132 UU126 Type: tandem, Name:  - 95 Type: tandem, Name:  - 100 Type: tandem, Name:  - 94 Type: tandem, Name:  - 98 Type: tandem, Name:  - 92 Type: tandem, Name:  - 99 Type: tandem, Name:  - 97 Type: tandem, Name:  - 93 Type: tandem, Name:  - 432 Type: tandem, Name:  - 96 UU127 atpE, - UU128 UU131 atpG, - UU130 UU125 atpB, - UU129 atpA, - UU132 UU126
* Calculated from Protein Sequence

Gene ID: UU128

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
atpE  

Definition:
ATP synthase epsilon chain

Gene Start:
169937

Gene Stop:
169527

Gene Length:
411

Molecular Weight*:
15874

pI*:
6.50

Net Charge*:
-1.04

EC:
3.6.1.34  

Functional Class:
energy metabolism; ATP-proton motive force interconversion  

Pathway: pathway table
Oxidative phosphorylation

Primary Evidence:
Nagata K, Takagi E, Satoh H, Okamura H, Tamura T. 1995. Growth inhibition of Ureaplasma urealyticum by the proton pump inhibitor lansoprazole: direct attribution to inhibition by lansoprazole of urease activity and urea-induced ATP synthesis in U. urealyticum. Antimicrob Agents Chemother 39(10):2187-92. Medline: 8619564.

Smith DG, Russell WC, Ingledew WJ, Thirkell D. 1993. Hydrolysis of urea by Ureaplasma urealyticum generates a transmembrane potential with resultant ATP synthesis. J Bacteriol. 175(11):3253-8. Medline: 8501029.

Romano N, La Licata R, Russo Alesi D. 1986. Energy Production in Ureaplasma urealyticum. Pediatr Infect Dis. 5(6 Suppl):S308-12. Medline: 3797330.

Secondary Evidence:
Das A, Ljungdahl LG. 1997. Composition and primary structure of the F1F0 ATP synthase from the obligately anaerobic bacterium Clostridium thermoaceticum. J Bacteriol 179(11):3746-55. Medline: 9171425.

Rasmussen OF, Shirvan MH, Margalit H, Christiansen C, Rottem S. 1992. Nucleotide sequence, organization and characterization of the atp genes and the encoded subunits of Mycoplasma gallisepticum ATPase. Biochem J. 285(Pt 3):881-8. Medline: 1386735.

Comment:
Function: Produces ATP from ADP in the presence of a proton gradient across the membrane. F-type ATPases have 2 components: CF(1) - the catalytic core and CF(0) - the membrane proton channel. CF(1) has five subunits: Alpha(3), Beta(3), Gamma(1), Delta(1) and Epsilon(1). CF(0) has three main subunits: A, B and C.

This gene is part of a cluster encompassing records UU128-UU138. The products of these genes are responsible for the ATP synthase complex, generation of ATP from ADP and Pi.

The complete list of predicted ATP synthases in U.u. is: UU053, UU054, UU128, UU129, UU130, UU132, UU133, UU134, UU135, UU136, UU137, and UU138.

This gene cluster is a likely candidate for the ATP synthase activity seen in conjunction with the urease present in Ureaplasma urealyticum (see UU427-UU434).

From: Molecular Biology and Pathogenicity of Mycoplasmas, Microbiology and Molecular Biology Reviews, Dec. 1998, p.1118-1119.Shmuel Razin, David Yogev, and Yehudith Naot.

The dependence of ureaplasmas on urea for growth has led to the hypothesis that intracellular urea hydrolysis and the resulting intracellular accumulation of ammonia/ammonium ions is coupled to ATP synthesis through a chemiosmotic type of mechanism. Experimental support for the generation of a transmembrane potential, with resultant ATP synthesis through the ureaplasmal F0F1-type ATPase, first provided by Romano et al. (1986, Medline: 3797330) was more recently extended and confirmed by Smith et al. (1993, Medline: 8501029) [...] It is worth mentioning at this point that the pH of the urogenital tract is usually on the acidic side of neutrality, corresponding to the pH values optimal for ureaplasma growth, maximum increase in delta P, maximum ammonia chemical potential, maximum urease activity, and maximum ATP generation.

Blast Summary:  PSI-Blast Search
A gapped BLAST reveals four significant hits to the ATP Synthase Epsilon Chain proteins from a number of organisms. For example: Residues 4-112 are 25% similar to the AtpC of M.genitalium (ATPE_MYCGE). Residues 7-112 are 25% similar to the ATP synthase epsilon chain of Euglena gracilis chloroplast (ATPE_EUGGR). The other two significant hits were to the ATP synthase epsilon chains of M.pneumoniae (ATPE_MYCPN), and M.gallisepticum (ATPE_MYCGA). In addition to these results, one iteration of PSI-BLAST resulted in significant hits to the ATP synthase epsilon chains of a number of organisms. For example: Significant hits were made to the ATP synthase epsilon chains of: C.vulgaris chloroplasts (ATPE_CHLVU), M.polymorpha cholorplast (ATPE_MARPO), Anabaena PCC7120 (a cyanobacterium) (ATPE_ANASP) and many others.

COGS Summary:  COGS Search
The phylogenetic pattern of COG0355 is eh--c-yu.
Cog name: ATP synthase epsilon subunit.
Functional class: C.
BeTs to -h--c--u.
Number of proteins in this genome belonging to this COG is 1



Blocks Summary:  Blocks Search
Residues 9-50, 19-60 and 68-104 rank in the 99.83th percentile to Block PF00401(A, A and B respectively), described as ATP synthase, Delta/Epsilon chain.

ProDom Summary:  Protein Domain Search
Residues 4-123 are 24% similar to a defined domain of ATPE_MYCGE.
Residues 7-80 are 25% similar to a defined domain of ATPE_PRODI.

Paralogs:  Local Blast Search
No paralogously related proteins found in U.urealyticum.

Pfam Summary:  Pfam Search
Residues 4 to 87 (E-value = 1.3e-06) place UU128 in the ATP-synt_DE_N family which is described as ATP synthase, Delta/Epsilon chain, beta-sandwich domain (PF02823)

Structural Feature(s):
Feature Type  Start  Stop
coil-coil  
86  
136

PDB Hit:


Gene Protein Sequence:
MANLTKLKIVTPYAQILEKDVYSVELKTSEGRITVLPDHNPLMSTIENHV
AYIRELPNTPRKPLLLLDGIVYIEQHQVRVFSDYFKFLDEIQIDEINSSL
NQLKHDLNNEEDDKKKLQLKSKIKLNESILIAYKDR$

Gene Nucleotide Sequence:  Sequence Viewer
ATGGCTAATTTAACTAAATTAAAAATTGTTACACCTTATGCACAAATTTT
AGAAAAAGATGTGTATAGTGTTGAATTAAAAACATCAGAAGGACGAATTA
CCGTTTTACCTGACCATAACCCTTTGATGTCAACAATTGAAAACCATGTT
GCTTATATTCGTGAATTACCAAATACTCCACGTAAACCACTATTATTATT
AGATGGTATAGTTTATATTGAACAACATCAAGTTCGTGTTTTTAGTGACT
ATTTTAAATTTTTAGATGAAATTCAAATTGATGAAATTAATTCTTCGTTA
AATCAATTAAAACATGATTTAAATAATGAAGAAGATGATAAGAAAAAACT
TCAATTAAAATCTAAAATTAAATTAAACGAATCAATTTTAATCGCTTATA
AAGATCGATAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy