Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Ureaplasma urealyticum Search Results

Record: 1 of 1  
MiniMap IGR93 IGR95 IGR94 IGR91 IGR92 UU111 potC, - UU109 UU112 sys,serS, - UU106 potA, - UU107 potD, - UU110 ftsH, - UU105 UU111 potC, - UU109 UU112 sys,serS, - UU106 potA, - UU107 potD, - UU110 ftsH, - UU105 Type: tandem, Name:  - 76 Type: tandem, Name:  - 81 Type: tandem, Name:  - 75 Type: tandem, Name:  - 79 Type: tandem, Name:  - 73 Type: tandem, Name:  - 80 Type: tandem, Name:  - 78 Type: tandem, Name:  - 74 Type: tandem, Name:  - 82 Type: tandem, Name:  - 77 UU111 potC, - UU109 UU112 sys,serS, - UU106 potA, - UU107 potD, - UU110 ftsH, - UU105 potB, - UU108 potB, - UU108
* Calculated from Protein Sequence

Gene ID: UU108

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
potB  

Definition:
spermidine/putrescine ABC transporter

Gene Start:
138334

Gene Stop:
139341

Gene Length:
1008

Molecular Weight*:
37432

pI*:
10.60

Net Charge*:
18.90

EC:
 

Functional Class:
transport and binding proteins; amino acids, peptides and amines  

Pathway: pathway table

Secondary Evidence:
Kashiwagi K, Miyamoto S, Nukui E, Kobayashi H, Igarashi K. 1993. Functions of potA and potD proteins in spermidine-preferential uptake system in Escherichia coli. J Biol Chem 268(26):19358-63. Medline: 8366082.

Comment:
UU108 is a predicted membrane spanning domain protein.

ATP-binding cassette proteins (ABC transporters) are associated with a myriad of biological processes, in both eukaryotes and prokaryotes. A majority of these processes involves the transport of small hydrophilic molecules across the cytoplasmic membrane of the organism in question. All of these proteins share a conserved domain of approximately two hundred amino acids (residues 32-377) which includes an ATP-binding site (motif search reveals an ATP-GTP-binding site at residues 39-46 based on similarity).

Putrescine/spermidine (and spermine) are all polyamines and appear to be universally present in prokaryotes and eukaryotes. However, the biological function(s) of polyamines is still unknown, although numerous effects on nucleic acid structure and enzyme activity have been reported in vitro. It is possible that polyamines play a role in prokaryotic protein synthesis. For a review on polyamines see Annual Review of Biochemistry (1984) 53: 749-790.

PotA, PotC and PotD are located at gene records UU107, UU109 and UU110 respectively.

The complete list of predicted ABC-related sequences in U.u. is: UU013, UU014, UU015, UU018, UU022, UU023, UU025, UU059, UU060, UU069, UU092, UU093, UU102, UU107, UU108, UU109, UU110, UU118, UU120, UU199, UU200, UU358, UU381, UU400, UU435, UU510, UU515, UU516, UU538, UU539, UU559, UU560, UU561, and UU562.

For a complete listing of Ureaplasma urealyticum ABC transporters,
alignments of transporters, nucleotide binding domain organization, and plasma membrane organization, please go to: (Home) or http://www.stdgen.lanl.gov, choose Bacteria under Analysis heading on the side bar, then click on the ABC transporters analysis subsection.

Blast Summary:  PSI-Blast Search
Gapped BLAST revealed a number of significant hits to PotB proteins. For example, residues 49-286 were 34% similar and 36% similar to the PotB proteins of M.pneumoniae (POTB_MYCPN) and M.genitalium (POTB_MYCGE) respectively. In addition to these hits, gapped BLAST revealed significant hits to the PotB proteins of H.influenzae (POTB_HAEIN), A.actinomycetemcomitans (3341855), E.coli (POTB_ECOLI), A.fulgidus (2648952) and B.burgdorferi (2688563). Residues 48-285 were 25% similar to the PotB homolog, PotH in E.coli (POTH_ECOLI).

Other significant hits were to MotC from A.tumefacions (involved in mannopine uptake), a putative polyamine ABC-transporter in S.coelicolor (pid:e1314856) and the PotC proteins from a number of bacterial organisms.

A BLAST of the STDPRO database also showed significant hits against the PotB/PotC proteins of M.genitalium and the PotB/PotC proteins of T.pallidum. Specifically MG043, MG044, and TP0653. No significant similarity to C.trachomatis.

COGS Summary:  COGS Search
The phylogenetic pattern of COG0555 is EHGPCm-u.
Cog name: Permeases, mainly amino acid.
Functional class: E/R.
BeTs to -h-pcm-u.
Number of proteins in this genome belonging to this COG is 2



Blocks Summary:  Blocks Search
Residues 146-159 and 214-233 show a weak homology to Block BL00402(A and B
respectively). This block is described as Binding-protein-dependent transport
systems inner membrane co., and while the homology is low (Combined
E value of 0.25), 2 of 2 domains match. In addition, members of the
pot operon for M.genitalium and M.pneumoniae (PotB and PotC) are
used in the Blocks comparison, giving this analysis credibility.

ProDom Summary:  Protein Domain Search
Residues 385-508 are 44% similar to a defined domain of POTA_MYCPN.
Residues 22-73 are 69% similar, and residues 300-343 are 84% similar to a defined domain of POTA_MYCGE.
In addition to these hits, there are more significant hits to other domain groups that also involve Transport Proteins, Transmembrane Permeases and Inner Membrane Amino-acid ABC Transporters.

Paralogs:  Local Blast Search
This protein is paralogously related to UU109 and UU199.
Residues 61-300 are 22% similar to UU109, a spermidine/putrescine transport system permease.
Residues 104-307 are 25% similar to UU199, a phosphate transport system permease.

Pfam Summary:  Pfam Search
Residues 109 to 325 (E-value = 1.8e-06) place UU108 in the BPD_transp_1 family which is described as Binding-protein-dependent transport system inner membrane component (PF00528)

Structural Feature(s):
Feature Type  Start  Stop
transmembrane  
54  
82
transmembrane  
100  
131
transmembrane  
135  
165
transmembrane  
182  
206
transmembrane  
224  
258
transmembrane  
291  
319

PDB Hit:


Gene Protein Sequence:
MNKQFNFNFAPSKLSDINKKNETVFFLKEVKVIKKNNRKHYKQTLFDKLK
MNKALILTIPYFLVTIFLLIIPLVSIIVKTFINNTDSTGVTTNIIDNWSV
ITPTIGMKIFNSLWIAAVATIFCLIIGYPFAYFLSIGKSKFLKAIAIALI
TSPIWMSMLVKLIGIKTFFDVVNGEINSTHGHIFTILGLVYINLPLMILP
IYTSLSTMPKNLVNASYDLGRGFFYTFFHIVIPYTKNALISGVWIVYLAA
FTSVVVSGFLNNDNAGGLIGGEIFAQGQDGISSGVQLSRSSTITLVISLI
LLGIYLIIVIIPKIVQLIYYKRKNLKKGVKNNEAD$

Gene Nucleotide Sequence:  Sequence Viewer
ATGAACAAGCAATTTAATTTCAATTTTGCACCATCTAAATTATCAGATAT
TAACAAAAAAAACGAAACAGTATTTTTTTTAAAAGAAGTTAAAGTAATTA
AAAAAAACAATCGTAAGCATTATAAACAAACTCTTTTTGATAAATTAAAA
ATGAATAAGGCACTAATATTAACAATTCCTTATTTTTTAGTAACTATTTT
TTTATTGATAATACCATTGGTTAGTATTATTGTTAAAACTTTTATTAACA
ATACTGATTCAACTGGTGTAACAACAAACATCATTGATAATTGGTCAGTA
ATTACGCCAACTATTGGAATGAAAATTTTTAATTCGTTATGAATCGCTGC
AGTTGCTACAATTTTTTGTTTAATTATTGGTTATCCATTTGCGTATTTTT
TAAGTATTGGTAAATCAAAATTTTTAAAAGCAATTGCAATTGCACTAATT
ACTTCACCAATTTGGATGAGTATGTTAGTAAAACTAATTGGTATTAAAAC
CTTTTTTGATGTAGTAAATGGAGAAATTAATAGTACACATGGGCACATTT
TTACTATTTTAGGTTTAGTTTATATTAATTTGCCATTAATGATTTTGCCT
ATTTATACATCTTTGTCAACAATGCCTAAAAACCTAGTTAATGCTAGTTA
TGATTTAGGAAGAGGTTTTTTTTACACCTTCTTTCATATTGTAATTCCTT
ACACTAAAAATGCTTTAATTTCAGGAGTTTGGATTGTTTATTTAGCAGCA
TTTACATCAGTTGTGGTTTCAGGTTTTTTAAATAATGATAACGCTGGAGG
ACTAATTGGTGGAGAAATCTTTGCTCAAGGACAAGACGGTATTTCAAGTG
GAGTTCAACTATCACGGTCATCAACAATTACTTTAGTAATTAGTTTAATT
TTATTAGGGATTTATCTTATTATTGTTATTATTCCAAAAATAGTCCAATT
AATTTATTACAAACGAAAAAATCTAAAAAAAGGAGTAAAGAATAATGAAG
CAGATTAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy