Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Ureaplasma urealyticum Search Results

Record: 1 of 1  
MiniMap IGR93 IGR90 IGR94 IGR91 IGR92 UU111 hpt,hprT, - UU104 potC, - UU109 sys,serS, - UU106 potA, - UU107 potD, - UU110 ftsH, - UU105 UU111 hpt,hprT, - UU104 potC, - UU109 sys,serS, - UU106 potA, - UU107 potD, - UU110 ftsH, - UU105 Type: tandem, Name:  - 75 Type: tandem, Name:  - 80 Type: tandem, Name:  - 74 Type: tandem, Name:  - 78 Type: tandem, Name:  - 72 Type: tandem, Name:  - 79 Type: tandem, Name:  - 77 Type: tandem, Name:  - 73 Type: tandem, Name:  - 76 UU111 hpt,hprT, - UU104 potC, - UU109 sys,serS, - UU106 potA, - UU107 potD, - UU110 ftsH, - UU105 potB, - UU108 potB, - UU108
* Calculated from Protein Sequence

Gene ID: UU107

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
potA  

Definition:
spermidine/putrescine ABC transporter

Gene Start:
136791

Gene Stop:
138350

Gene Length:
1560

Molecular Weight*:
59822

pI*:
9.10

Net Charge*:
6.36

EC:
 

Functional Class:
transport and binding proteins; amino acids, peptides and amines  

Pathway: pathway table

Secondary Evidence:
Kashiwagi K, Miyamoto S, Nukui E, Kobayashi H, Igarashi K. 1993. Functions of potA and potD proteins in spermidine-preferential uptake system in Escherichia coli. J Biol Chem 268(26):19358-63. Medline: 8366082.

Comment:
This protein may be the nucleotide binding domain.

ATP-binding cassette proteins (ABC transporters) are associated with a myriad of biological processes, in both eukaryotes and prokaryotes. A majority of these processes involves the transport of small hydrophilic molecules across the cytoplasmic membrane of the organism in question. All of these proteins share a conserved domain of approximately two hundred amino acids (residues 32-377) which includes an ATP-binding site (motif search reveals an ATP-GTP-binding site at residues 39-46 based on similarity).

Putrescine/spermidine (and spermine) are all polyamines and appear to be universally present in prokaryotes and eukaryotes. However, the biological function(s) of polyamines is still unknown, although numerous effects on nucleic acid structure and enzyme activity have been reported in vitro. It is possible that polyamines play a role in prokaryotic protein synthesis. For a review on polyamines see Annual Review of Biochemistry (1984) 53: 749-790.

PotB, PotC and PotD are found at records UU108, UU109 and UU110 respectively.

The complete list of predicted ABC-related sequences in U.u. is: UU013, UU014, UU015, UU018, UU022, UU023, UU025, UU059, UU060, UU069, UU092, UU093, UU102, UU107, UU108, UU109, UU110, UU118, UU120, UU199, UU200, UU358, UU381, UU400, UU435, UU510, UU515,
UU516, UU538, UU539, UU559, UU560, UU561, and UU562.

For a complete listing of Ureaplasma urealyticum ABC transporters,
alignments of transporters, nucleotide binding domain organization, and plasma membrane organization, please go to: (Home) or http://www.stdgen.lanl.gov, choose Bacteria under Analysis heading on the side bar, then click on the ABC transporters analysis subsection.

Blast Summary:  PSI-Blast Search
Gapped BLAST reveals several significant hits to putative spermidine/putrescine transport ATP-binding protein PotA homologs. For example: residues 2-509 are 44% similar to the putative PotA homolog found in M.genitalium (POTA_MYCGE). Likewise, residues 2-509 are 42% similar to the putative PotA homolog of M. pneumoniae (POTA_MYCPN). Other significant hits to putative PotA proteins were found in B. burgdorferi, A. fulgidus, H. influenzae, E. coli(POTA_ECOLI) and A. actinomycetemcomitans (AF077856).

Other significant hits were found against other putative ATP-binding transport proteins in M.pneumoniae (putative), Synechococcus PCC7942 (Sulfate Transport ATP-binding Protein CysA)(J. Bacteriol. 173 (9), 2739-2750 (1991)), E. coli (YDCT_ECOLI) and a putative maltose transporter of B. firmus (AF084104).

UU107 is significantly similar to MP0099, MG042, MP0020, MG187, TP0652, all predicted proteins of the spermidine/putrescine ABC transporter. UU107 is also significantly similar to predicted members of other ABC transport systems, TP0804, UU559, CPn0280, and CT202.


COGS Summary:  COGS Search
The phylogenetic pattern of COG0444 is EHGPCMYU.
Cog name: ATPase subunits of ABC transporters.
Functional class: E/P/G/R.
BeTs to e-g-cmyu.
Number of proteins in this genome belonging to this COG is 16



Blocks Summary:  Blocks Search
Residues 37-48 and 301-332 rank in the 99.98th percentile to Block BL00211(A and B respectively), described as ABC transporters family. The best hit within BL00211B is POTA_MYCPN.

Residues 34-49 rank in the 98.80th percentile to Block PR00364A, described as Disease Resistance Protein.

Residues 34-49 rank in the 96.18th percentile to Block PR00318A, described as Alpha G-Protein (Transducin) Signature.

ProDom Summary:  Protein Domain Search
Residues 385-508 are 44% similar to a defined domain of POTA_MYCPN.
Residues 22-73 are 69% similar, and residues 300-343 are 84% similar to a defined domain of POTA_MYCGE.
Residues 344-382 are 71% similar to a defined domain of YDCT_ECOLI, a transport ATP-binding protein.

Paralogs:  Local Blast Search
A BLAST reveals a number of potential paralogs within the U.urealyticum genome. Residues 2-391 are 23% similar to UU559. Residues 29-65 and 195-390 are 40% and 30% similar (respectively) to UU435. Residues 300-395 and 29-113 are 41% and 28% similar (respectively) to UU539. Residues 22-52 and 284-388 are 48% and 42% similar (respectively) to UU069. Residues 5-134 and 109-382 are 33% and 25% similar (respectively) to UU118. Residues 6-389 are 23% similar to UU538. Residues 22-102 and 295-401 are 30% and 35% similar (respectively) to UU200. Other significant hits were to UU560, UU093, UU015, UU059 and UU102.


Pfam Summary:  Pfam Search
Residues 32 to 377 (E-value = 1.8e-67) place UU107 in the ABC_tran family which is described as ABC transporter (PF00005)

Structural Feature(s):
Feature Type  Start  Stop
coil-coil  
122  
184
coil-coil  
258  
287

PDB Hit:
gi|6573453|pdb|1B0U|A Chain A, Atp-Binding Subunit Of The Histidine Permease From Salmonella Typhimurium

Gene Protein Sequence:
MEKTLLHLRDITKIYDDGFAAVNKFDLKIKKGEFVTLLGPSGCGKTTMLK
IIAGFEQPTNGKILYNGIDIKDMPIRLRPTSTVFQDYALFPNMTVKQNIK
YGLKLMRKPKDNVDQSIYLQADKVYNSASKKANEKIKELKKQRRGLLAEI
KKMDLKYQKNKNIFEIKEMRKNQYLGTLDELYQKQGINKNGKPGFLNYFK
SWFSHEKLNLNDPIDREIFNLKKAYKEKSGLDKRYDKITYKYNDLDYWES
YWATYPQLKKEQFENKNITRLLTKEEVEKEANRVINLVGLSARKDSYPSD
LSGGMQQRVALARSLVIQPEIILLDEPLSALDAKVRKQLQDELKKLHKNL
GITFILVTHDQEEALSLSDKVVVMSNGQIEQVGKPSDIYDSPNSLWVANF
IGKTNIFEGHYIAKGEVEFDGITSKTDVINGFSENEACYIMIRPEDFDVV
KKDEGSINARVESVLYKGLMWDIKCKYNDMIISVEGVNKVNEGDEIGLDW
DDIDVHVIKKDYLNNEQAI$

Gene Nucleotide Sequence:  Sequence Viewer
ATGGAAAAAACACTCCTACATCTTAGAGATATTACAAAAATCTATGATGA
TGGATTTGCTGCTGTAAACAAATTTGATTTAAAAATAAAAAAAGGTGAAT
TTGTCACTTTATTAGGACCAAGTGGTTGTGGTAAGACAACAATGTTAAAA
ATTATTGCTGGATTTGAACAACCTACTAATGGAAAAATTTTATATAATGG
AATTGATATTAAGGATATGCCAATTCGACTAAGACCAACATCAACGGTGT
TTCAAGACTATGCGCTATTCCCTAATATGACTGTTAAACAAAACATAAAA
TATGGTTTAAAACTAATGCGTAAACCAAAAGATAATGTTGATCAAAGTAT
TTATTTGCAAGCTGATAAAGTTTATAATTCAGCTTCTAAAAAAGCAAATG
AAAAAATTAAAGAATTAAAAAAACAAAGACGCGGGTTATTGGCTGAAATC
AAAAAAATGGATCTTAAATACCAAAAGAATAAGAACATTTTTGAAATAAA
AGAAATGCGAAAAAACCAATATCTTGGCACACTTGATGAACTTTATCAAA
AACAAGGTATTAATAAAAATGGAAAACCAGGTTTTTTAAATTATTTTAAA
AGTTGATTTAGTCATGAAAAATTGAATTTAAACGATCCAATTGATAGAGA
AATTTTTAATTTAAAAAAAGCATATAAAGAAAAAAGTGGATTAGATAAAC
GATATGATAAGATTACTTACAAATATAATGATCTTGATTATTGAGAATCA
TATTGAGCAACTTATCCACAATTAAAAAAAGAACAATTTGAAAATAAAAA
TATTACACGATTATTAACTAAAGAAGAAGTCGAAAAAGAAGCAAATCGTG
TAATTAATTTAGTTGGTTTAAGTGCACGTAAGGATTCGTATCCAAGTGAT
TTATCGGGTGGTATGCAACAACGTGTTGCACTAGCACGTTCACTAGTAAT
ACAGCCTGAAATTATTTTATTAGATGAACCATTAAGTGCACTAGATGCAA
AAGTACGTAAACAATTACAAGATGAATTAAAAAAACTACATAAAAATTTA
GGAATCACCTTTATTTTAGTAACTCATGATCAAGAAGAGGCTTTAAGTTT
ATCAGATAAAGTTGTGGTTATGTCAAATGGTCAAATCGAACAAGTCGGTA
AACCAAGTGATATTTATGATTCACCAAATTCATTGTGAGTAGCTAATTTT
ATTGGTAAAACTAATATTTTTGAAGGTCATTATATTGCTAAAGGTGAAGT
TGAATTTGATGGTATTACTTCTAAAACAGATGTGATTAATGGTTTTAGCG
AAAATGAAGCGTGTTATATTATGATTCGCCCAGAAGACTTTGATGTTGTT
AAAAAAGACGAAGGATCAATTAATGCTAGAGTTGAATCAGTATTATATAA
AGGGTTAATGTGAGATATTAAGTGTAAATATAATGACATGATTATTAGTG
TTGAAGGTGTTAATAAAGTTAATGAAGGTGATGAAATTGGTTTAGATTGA
GATGACATTGATGTGCATGTAATTAAAAAGGATTATTTAAATAATGAACA
AGCAATTTAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy