Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Ureaplasma urealyticum Search Results

Record: 1 of 1  
MiniMap IGR90 IGR88 IGR89 IGR86 IGR91 IGR87 UU101 hsdM, - UU100 hpt,hprT, - UU104 sys,serS, - UU106 UU103 ftsH, - UU105 uvrA, - UU102 UU101 hsdM, - UU100 hpt,hprT, - UU104 sys,serS, - UU106 UU103 ftsH, - UU105 uvrA, - UU102 Type: tandem, Name:  - 398 Type: tandem, Name:  - 70 Type: tandem, Name:  - 71 Type: tandem, Name:  - 72 UU101 hsdM, - UU100 hpt,hprT, - UU104 sys,serS, - UU106 UU103 ftsH, - UU105 uvrA, - UU102
* Calculated from Protein Sequence

Gene ID: UU103

DNA Molecule Name:
1  

Genbank ID:


Gene Name:


Definition:
hypothetical protein

Gene Start:
130540

Gene Stop:
132204

Gene Length:
1665

Molecular Weight*:
65510

pI*:
10.00

Net Charge*:
19.87

EC:
 

Functional Class:
hypothetical  

Pathway: pathway table

Comment:


Blast Summary:  PSI-Blast Search
No significant similarity with gapped BLAST.

No similarity to C. trachomatis, C. pneumoniae, M. genitalium, M. pneumoniae, or T. pallidum.

COGS Summary:  COGS Search
No related COG.

Blocks Summary:  Blocks Search
Residues 179-203 match in the 99.47th percentile to block BL00719B concerned with Glycosyl hydrolases family 2 proteins.

ProDom Summary:  Protein Domain Search
No signifacnt matches to a domain found in ProDom.

Paralogs:  Local Blast Search
There are no paralogs in U.u., however there is weak similarity to UU125, UU292, UU485, UU505 and UU055, all hypothetical proteins.

Pfam Summary:  Pfam Search
No significant hits to the Pfam 11.0 database

Structural Feature(s):
Feature Type  Start  Stop
gram positive signal  
1  
28
non-globular  
29  
126
non-globular  
358  
459
coil-coil  
461  
488

PDB Hit:
None.

Gene Protein Sequence:
MKHKTKKITLLIAGITLTSLCTIFAITACSKQKSQPNPKIKPNKIIEKID
QAFFNEFKTKIEQKRTLPNIKITSTFKIPFEKNENTLKSPLFKIGEKSVF
DLKQNEIPITWVQDLKDYFLSQKTILTYYSLANLKLTGNDAKDAYFLEFI
QYIQNMQQKGIISEDFYQQLWYLISEISDYDMQNGILRSVYRIANPKLAI
KDFYLDGSLYGFKKEKSKYMNFTSLFQWPNAEEKATFDVVFKNKNSAQSY
TKKIELIYSKEKKFILDSLINYSEFTPGEYELVSIKKHDDMNAKNLINPN
NPNIAKIFKIKVFKENEKFKPITLTSINQQEADEYDRQRNQIIHKNNSEI
GILDDSNKIKELGTFLYFKKPLSEITINDFDRYFRTYFICPEQDFNDFSR
QYKITKIDKQKQIIELSILHINNKTNEIYSSPINFKFYYKKIYDINKNTD
ARLDLSFDESKKEQKQKLQELVNKLNFDKLTYNDLSELAVVMFEDVDLEN
TKIYVEMIKNKDRSITLKAFVDKAFKNGKLKVSNKPDILIKEFKINYFMP
NYFK$

Gene Nucleotide Sequence:  Sequence Viewer
ATGAAACATAAGACAAAAAAAATAACGCTTTTAATAGCAGGAATTACTTT
AACTTCATTATGTACAATTTTTGCTATTACAGCTTGTAGTAAGCAAAAAT
CACAACCAAATCCAAAAATAAAACCCAATAAAATTATTGAGAAAATTGAT
CAAGCATTTTTTAATGAATTTAAAACAAAAATTGAACAAAAACGCACACT
TCCAAATATTAAAATCACTTCAACCTTTAAAATTCCTTTTGAGAAAAACG
AAAACACTTTAAAATCCCCACTTTTTAAAATTGGTGAGAAATCGGTTTTT
GATTTAAAACAAAATGAAATTCCAATAACATGAGTTCAAGATTTAAAAGA
TTATTTTTTATCGCAAAAAACCATTTTAACTTATTATTCATTAGCAAATT
TAAAACTAACAGGCAATGATGCTAAAGATGCATATTTTTTAGAATTTATT
CAATATATTCAAAATATGCAACAAAAAGGAATTATATCAGAAGATTTTTA
TCAACAATTATGATATTTAATTAGTGAAATTAGTGACTATGATATGCAAA
ATGGTATTTTACGTTCAGTATATCGTATCGCTAATCCTAAACTTGCAATC
AAGGATTTTTACCTTGATGGTTCGCTTTATGGATTTAAAAAAGAAAAAAG
TAAATACATGAATTTTACAAGTTTGTTTCAATGACCGAATGCAGAAGAAA
AAGCAACTTTTGATGTTGTTTTTAAAAATAAAAACAGCGCTCAGTCTTAT
ACAAAAAAGATTGAACTGATTTATTCTAAAGAAAAAAAATTTATTTTAGA
TTCATTAATTAATTATAGTGAGTTTACTCCAGGTGAATATGAATTAGTAT
CAATTAAAAAACATGATGATATGAATGCCAAGAATTTGATTAATCCCAAC
AACCCTAATATTGCAAAAATTTTTAAAATTAAAGTTTTTAAAGAAAACGA
AAAATTTAAACCAATAACCTTAACGTCAATTAATCAACAAGAAGCGGATG
AATATGATCGACAAAGAAATCAAATTATTCATAAAAATAATTCAGAAATT
GGGATATTAGATGATTCAAATAAAATTAAAGAGTTAGGAACTTTTTTATA
TTTTAAAAAACCTTTATCTGAAATTACAATCAACGATTTTGATCGTTATT
TTAGAACTTATTTTATTTGTCCAGAGCAAGATTTTAATGATTTTAGTCGT
CAATATAAAATTACTAAAATTGATAAACAAAAACAAATAATAGAACTAAG
TATATTACATATTAATAATAAAACAAATGAAATTTATAGTTCACCAATTA
ATTTTAAGTTTTATTACAAAAAAATATATGATATTAACAAAAACACTGAT
GCACGATTAGATTTAAGTTTTGATGAATCTAAAAAAGAACAAAAACAAAA
ACTACAAGAGTTAGTTAATAAATTAAATTTTGATAAACTTACTTATAATG
ATTTAAGTGAATTAGCTGTTGTGATGTTTGAGGATGTGGATTTAGAAAAC
ACTAAAATTTATGTTGAAATGATTAAAAATAAAGATCGTTCAATTACTTT
AAAAGCTTTTGTTGATAAAGCTTTTAAAAATGGAAAATTAAAGGTAAGTA
ATAAACCAGATATTTTAATAAAAGAGTTTAAAATAAACTATTTTATGCCT
AATTACTTTAAATAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy