Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Ureaplasma urealyticum Search Results

Record: 1 of 1  
MiniMap IGR84 IGR88 IGR82 IGR83 IGR86 IGR85 IGR87 UU101 hsdS, - UU096 hsdR, - UU095 hsdM, - UU100 hsdS, - UU099 hsdM, - UU098 UU103 uvrA, - UU102 UU101 hsdS, - UU096 hsdR, - UU095 hsdM, - UU100 hsdS, - UU099 hsdM, - UU098 UU103 uvrA, - UU102 Type: tandem, Name:  - 439 Type: tandem, Name:  - 69 Type: tandem, Name:  - 70 Type: tandem, Name:  - 379 UU101 hsdS, - UU096 hsdR, - UU095 hsdS, - UU097 hsdS, - UU097 hsdM, - UU100 hsdS, - UU099 hsdM, - UU098 UU103 uvrA, - UU102
* Calculated from Protein Sequence

Gene ID: UU099

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
hsdS  

Definition:
type I restriction enzyme S protein

Gene Start:
125367

Gene Stop:
126272

Gene Length:
906

Molecular Weight*:
34964

pI*:
9.00

Net Charge*:
4.35

EC:
3.1.21.3  

Functional Class:
replication; DNA replication, restriction, modification, recombination, and repair  

Pathway: pathway table

Comment:
The type 1 restriction and modification system consists of R, S and M
components.

See UU095, a predicted hsdR sequence; UU096, a predicted hsdS sequence; UU097, a predicted hsdS sequence; UU098, a predicted hsdM sequence; and UU100, a predicted hsdM sequence.

Blast Summary:  PSI-Blast Search
Hits in gapped BLAST to restriction enzymes, almost exclusively to Mycoplasmas; e.g. residues 138-296 are 39% similar to a restriction enzyme ecokI specificity protein homolog H91_orf268 of Mycoplasma pneumoniae; residues 215-296 are 62% similar to hsdS1B protein homolog H10_orf187V of Mycoplasma pneumoniae; and residues 58-301 are 30% similar to (AF076986) restriction-modification enzyme MpuUIII S subunit of Mycoplasma pulmonis. No significant similarity to M.genitalium, C.trachomatis, or T.pallidum.


COGS Summary:  COGS Search
The phylogenetic pattern of COG0734 is -h-P---U.
Cog name: Restriction endonuclease S subunits.
Functional class: L.
BeTs to -h-p---u.
Number of proteins in this genome belonging to this COG is 3



Blocks Summary:  Blocks Search
None.

ProDom Summary:  Protein Domain Search
Residues 97-186 are 46% similar and residues 20-172 are 32% similar to a defined domain of O25519_XXXXX, a restriction enzyme.
Residues 253-295 are 69% similar and residues 210-251 are 50% similar to a defined domain of P75488_MYCPN, a resriction enzyme.

Paralogs:  Local Blast Search
This protein is paralogously related to UU096, UU097 and UU447, all predicted type I restriction enzyme S proteins/fragments. Residues 2-190 are 34% similar to UU096, residues 100-189 are 48% similar to UU097, and residues 123-235 are 27% similar to UU447.


Pfam Summary:  Pfam Search
Residues 16 to 158 (E-value = 1.5e-16) place UU099 in the Methylase_S family which is described as Type I restriction modification DNA specificity domain (PF01420)

Structural Feature(s):
Feature Type  Start  Stop
non-globular  
91  
148
coil-coil  
149  
176

PDB Hit:


Gene Protein Sequence:
MNKIEKLINEFCPNGVEFKKLKNIITVAPKSPFGVTKLLKMEKGNYLTIT
SGKKSFYVDNFLVDGEYIFVNDGGQADIKYNFGKTMYSDHIFAFKVNEYN
TKYLYFYLLNISNFINKKLFIGSTLKNLNKKEFLNLAIPIPPISIQNKIV
EILDKYTELETELETELETELELRNKQYIYYRNELLNFNKNQTLLKKIMD
SDDIKSIDHKIEFKKIEYVCEIKRGQVYSKEFINSNKGNYPVYSSQSLND
GVLGNINKYDFDGEYVTWTTDGAYAGTVFYRKGKFSITNVCGILKVFDNS
N$

Gene Nucleotide Sequence:  Sequence Viewer
ATGAATAAAATTGAAAAATTAATTAATGAGTTCTGCCCTAATGGAGTGGA
GTTTAAAAAATTAAAAAATATAATTACAGTGGCTCCTAAATCACCTTTTG
GAGTTACAAAACTTTTAAAAATGGAAAAGGGAAATTATTTAACAATAACA
TCAGGGAAGAAATCATTTTATGTTGACAATTTTTTAGTTGATGGAGAATA
TATATTTGTTAATGATGGCGGTCAAGCAGATATAAAATATAATTTTGGAA
AAACAATGTATTCTGATCATATATTCGCATTCAAAGTAAATGAATATAAC
ACAAAATATCTTTACTTCTATCTATTAAATATTTCTAATTTTATTAATAA
AAAATTGTTTATAGGTAGTACATTAAAAAATTTAAATAAAAAAGAATTTT
TAAATCTTGCAATCCCTATTCCGCCCATTTCAATCCAAAATAAAATTGTT
GAAATATTAGACAAGTATACAGAATTAGAAACAGAATTAGAAACAGAATT
AGAAACAGAATTAGAACTTAGAAATAAGCAGTATATATATTATCGCAATG
AATTACTAAACTTTAATAAAAATCAAACATTATTAAAGAAAATAATGGAC
AGTGATGATATAAAATCTATTGATCATAAAATTGAGTTTAAAAAGATTGA
ATATGTGTGTGAAATAAAAAGAGGTCAAGTATACTCTAAGGAATTTATTA
ATTCTAATAAAGGAAATTATCCAGTATATTCATCACAAAGTTTAAATGAT
GGTGTTTTAGGAAATATTAATAAATATGATTTTGATGGTGAATATGTTAC
TTGAACTACAGATGGTGCATATGCGGGAACTGTTTTCTATAGAAAAGGCA
AATTTTCAATAACAAATGTGTGTGGAATATTAAAGGTGTTTGATAATTCT
AATTAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy