Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Ureaplasma urealyticum Search Results

Record: 1 of 1  
MiniMap IGR84 IGR82 IGR83 IGR86 IGR85 IGR87 IGR81 UU101 hsdS, - UU096 hsdR, - UU095 hsdM, - UU100 hsdS, - UU099 hsdM, - UU098 uvrA, - UU102 UU101 hsdS, - UU096 hsdR, - UU095 hsdM, - UU100 hsdS, - UU099 hsdM, - UU098 uvrA, - UU102 Type: tandem, Name:  - 69 Type: tandem, Name:  - 379 Type: tandem, Name:  - 439 UU101 hsdS, - UU096 hsdR, - UU095 hsdS, - UU097 hsdS, - UU097 hsdM, - UU100 hsdS, - UU099 hsdM, - UU098 uvrA, - UU102
* Calculated from Protein Sequence

Gene ID: UU098

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
hsdM  

Definition:
type I restriction enzyme M protein

Gene Start:
124317

Gene Stop:
125363

Gene Length:
1047

Molecular Weight*:
39502

pI*:
6.50

Net Charge*:
-1.67

EC:
3.1.21.3  

Functional Class:
replication; DNA replication, restriction, modification, recombination, and repair  

Pathway: pathway table

Comment:
The type 1 restriction and modification system consists of R, S and M components.

See UU095, a predicted hsdR sequence; UU096, a predicted hsdS sequence; UU097, a predicted hsdS sequence; UU099, a predicted hsdS sequence; and UU100, a predicted hsdM sequence.

Blast Summary:  PSI-Blast Search
Several hits in gapped BLAST to type I restriction enzyme M proteins (hsdM). E.g. 55% similarity to the experimentally documented hsdM protein (pid:450688) of E.coli. Residues 1-347 are 61% similar to the predicted hsdM protein of H.pylori (AE000596). No significant similarity to T.pallidum, C.trachomatis or M.genitalium.


COGS Summary:  COGS Search
The phylogenetic pattern of COG0286 is eH-p-M-U.
Cog name: Type I restriction-modification system methyltransferase subunit.
Functional class: L.
BeTs to -h-p-m-u.
Number of proteins in this genome belonging to this COG is 2



Blocks Summary:  Blocks Search
Significant (99.65%) hit to block PR00433A (Interleukin-6/G-CSF/MGF Family Signature) Residues: 324-339. Corresponds to a coil region.

Significant (99.31%) hit to block BL01261(A and C) (Uncharacterized Protein Family) UPF0020 proteins). Residues: 22-73 and 126-135.

Significant (98.80%) hit to block BL00092 (N-6 Adenine-specific DNA methylases proteins.) Residues: 126-134.

Significant (84.99%) hit to block BL00093(A and C) (N-4 cytosine-specific DNA methylases proteins.) Residues: 120-134 and 56-66.

ProDom Summary:  Protein Domain Search
Residues 140-319 and 1-138 are respectively 60% and 72% similar to defined domains of O25521_XXXXX, a type I restriction enzyme M protein.

Paralogs:  Local Blast Search
This protein is paralogously related to UU036 which is a hypothetical protein. Residues 122-342 show 25% similarity to UU036.

In addition, this protein has a paralogous relationship with UU004, a predicted protoporphyrinogen oxidase, hemK. Residues 24-134 show 29% similarity to UU004.

Pfam Summary:  Pfam Search
Residues 136 to 300 (E-value = 6.6e-68) place UU098 in the N6_Mtase family which is described as N-6 DNA Methylase (PF02384)

Structural Feature(s):
Feature Type  Start  Stop
non-globular  
219  
310
coil-coil  
311  
348

PDB Hit:


Gene Protein Sequence:
VFGDAYEYLMSMYAANAGKSGGEFFTPQEVSELLVELTLIDFNNENKDVR
RKIGKVYDPCCGSGSLLLKYAKLNEGVKFYGQEINLTTYNLARINMFLHN
IGYDKFDIKLGDTLLDPKHNDDKPFDAIVSNPPYSTKWEGKSNPLLANDE
RFHVTQLAPKGKADFAFVLHILHNLSSSGTAAIVMFPGTLYRDHAEQDIR
KYLVDNVNVVDSVIQLPDNLFFGTSISTCIIVLRKNKNNNDNANGILFVD
ASKEFVKSGIKNKLTNANIKKIVDTIRFKKEVTYFSKLVSREEVKNKNYN
LSVNTYVEKEDTSEKIDIKLLNMQIKEIVAKIEKLRKEIDEIVLELEE$

Gene Nucleotide Sequence:  Sequence Viewer
GTGTTCGGTGATGCTTATGAATACTTAATGAGTATGTATGCTGCAAATGC
AGGTAAATCAGGGGGAGAATTTTTCACCCCTCAAGAAGTTAGTGAACTAT
TAGTAGAATTAACATTAATTGATTTTAATAATGAAAATAAAGATGTTAGA
AGAAAAATTGGAAAAGTTTATGATCCATGTTGTGGTTCTGGATCATTACT
TTTAAAGTATGCAAAATTAAATGAAGGAGTTAAATTTTATGGTCAAGAAA
TTAATCTTACTACGTATAATTTAGCAAGAATTAATATGTTTTTGCACAAT
ATAGGTTATGATAAATTTGATATCAAATTAGGTGATACATTACTAGATCC
TAAACATAATGATGATAAACCTTTTGATGCAATTGTTTCAAATCCTCCAT
ATTCAACAAAATGGGAGGGAAAATCAAATCCTTTATTAGCTAACGATGAG
CGATTTCATGTTACTCAATTAGCACCTAAAGGAAAAGCTGATTTTGCTTT
TGTATTGCATATACTTCATAATTTATCTTCTAGTGGAACAGCAGCTATAG
TTATGTTTCCAGGAACTTTATATCGAGATCATGCAGAACAAGATATTAGA
AAATATTTAGTTGATAATGTTAATGTTGTAGATAGTGTGATTCAATTACC
AGATAATCTGTTTTTTGGAACAAGTATTTCAACATGTATTATAGTTTTAA
GAAAAAACAAAAACAACAATGATAATGCTAATGGTATCTTGTTTGTTGAT
GCATCAAAAGAATTTGTTAAATCTGGTATCAAAAACAAATTAACCAATGC
TAATATTAAAAAAATAGTTGATACGATTCGTTTCAAAAAAGAAGTAACTT
ATTTTTCAAAACTTGTATCACGAGAAGAAGTTAAAAATAAAAACTATAAT
TTATCAGTTAACACATATGTGGAAAAAGAAGACACGTCAGAAAAAATTGA
TATTAAATTATTAAATATGCAAATTAAAGAAATTGTGGCTAAAATCGAAA
AGTTAAGAAAAGAAATTGATGAAATTGTTTTAGAATTAGAAGAATAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy