Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Ureaplasma urealyticum Search Results

Record: 1 of 1  
MiniMap IGR84 IGR82 IGR83 IGR86 IGR85 IGR87 IGR81 UU101 hsdS, - UU096 hsdR, - UU095 hsdM, - UU100 hsdS, - UU099 hsdM, - UU098 uvrA, - UU102 UU101 hsdS, - UU096 hsdR, - UU095 hsdM, - UU100 hsdS, - UU099 hsdM, - UU098 uvrA, - UU102 Type: tandem, Name:  - 69 Type: tandem, Name:  - 379 Type: tandem, Name:  - 439 UU101 hsdS, - UU096 hsdR, - UU095 hsdS, - UU097 hsdS, - UU097 hsdM, - UU100 hsdS, - UU099 hsdM, - UU098 uvrA, - UU102
* Calculated from Protein Sequence

Gene ID: UU097

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
hsdS  

Definition:
type I restriction enzyme S protein

Gene Start:
124286

Gene Stop:
123975

Gene Length:
312

Molecular Weight*:
12148

pI*:
10.30

Net Charge*:
5.23

EC:
3.1.21.3  

Functional Class:
replication; DNA replication, restriction, modification, recombination, and repair  

Pathway: pathway table

Comment:
The type 1 restriction and modification system consists of R, S and M components.

See UU095, a predicted hsdR sequence; UU096, a predicted hsdS sequence; UU098, a predicted hsdM sequence; UU099, a predicted hsdS sequence; and UU100, a predicted hsdM sequence. UU097 and UU096 should perhaps be fused into a single cds with an internal stop or frameshift as UU096 starts with a tyrosine. UU097 starts with Ile.

Blast Summary:  PSI-Blast Search
Several weak hits in gapped BLAST to type I restriction enzyme ecokI related sequences, e.g. residues 1-94 are 37% similar to the M.pneumoniae homolog (AE000046). Residues 11-94 are 40% similar to the H.influenza homolog (U32706). No similarity to M.genitalium, T.pallidum, or C.trachomatis.


COGS Summary:  COGS Search
The phylogenetic pattern of COG0734 is -h-P---U.
Cog name: Restriction endonuclease S subunits.
Functional class: L.
BeTs to -h-p---u.
Number of proteins in this genome belonging to this COG is 3



Blocks Summary:  Blocks Search
None.

ProDom Summary:  Protein Domain Search
Residues 1-91 are 42% similar to an hsdS domain of P75416_MYCPN.

Paralogs:  Local Blast Search
UU097 is paralogously related to UU096 and UU099, both predicted hsdS sequences. Residues 9-94 are 58% similar to UU096; residues 9-95 are 48% similar to UU099.


Pfam Summary:  Pfam Search
No significant hits to the Pfam 11.0 database

PDB Hit:


Gene Protein Sequence:
IKFINSNLNTKYLSFILRKITKKHVNQASGNPKLMSNVMQEIIIPIPPIS
IQNKIVEILDKLETYTKDINTGLPLEIEQRKKQYEYYRNKLLDFDNIARE
RES$

Gene Nucleotide Sequence:  Sequence Viewer
ATCAAGTTCATTAATTCTAATTTAAACACAAAATATTTGAGCTTTATTTT
GAGAAAAATTACTAAAAAACATGTAAATCAAGCATCAGGAAATCCAAAAT
TAATGAGTAATGTTATGCAAGAAATCATAATCCCTATTCCGCCCATTTCA
ATCCAAAATAAAATTGTTGAGATTTTAGATAAATTGGAAACATATACGAA
AGATATTAATACTGGACTTCCTCTTGAAATCGAACAACGTAAAAAACAAT
ACGAATATTATCGTAATAAATTATTAGACTTTGATAATATAGCACGAGAG
AGAGAGAGCTAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy