Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Ureaplasma urealyticum Search Results

Record: 1 of 1  
MiniMap IGR84 IGR82 IGR83 IGR86 IGR85 IGR87 IGR81 UU101 hsdS, - UU096 hsdR, - UU095 hsdM, - UU100 hsdS, - UU099 hsdM, - UU098 uvrA, - UU102 UU101 hsdS, - UU096 hsdR, - UU095 hsdM, - UU100 hsdS, - UU099 hsdM, - UU098 uvrA, - UU102 Type: tandem, Name:  - 69 Type: tandem, Name:  - 379 Type: tandem, Name:  - 439 UU101 hsdS, - UU096 hsdR, - UU095 hsdS, - UU097 hsdS, - UU097 hsdM, - UU100 hsdS, - UU099 hsdM, - UU098 uvrA, - UU102
* Calculated from Protein Sequence

Gene ID: UU096

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
hsdS  

Definition:
type I restriction enzyme S protein

Gene Start:
123999

Gene Stop:
123316

Gene Length:
684

Molecular Weight*:
27073

pI*:
10.10

Net Charge*:
11.63

EC:
3.1.21.3  

Functional Class:
replication; DNA replication, restriction, modification, recombination, and repair  

Pathway: pathway table

Comment:
The type 1 restriction and modification system consists of R, S and M components.

Note that UU095 and UU096 are both similar to H.pylori hsdR and hsdS proteins.? UU096 has a high A+T region near the 5' end of the cds. Note that the start aa is tyrosine, an aa not known to be used by mycoplasma for a start. Could UU096 fuse with UU097 into a single cds? Note displacement in BLAST with some ortholog starts. UU097 starts with Ile. See UU446 and UU447, other predicted hsdS sequences with noncanonical starts, his and gly.

See UU095, a predicted hsdR sequence; UU097, a predicted hsdS sequence; UU098, a predicted hsdM sequence; UU099, a predicted hsdS sequence; and UU100, a predicted hsdM sequence.

Blast Summary:  PSI-Blast Search
A small number of significant hits in gapped BLAST to putative hsdS sequences: residues 10-225 are 31% similar to the predicted enzyme from H.pylori (AE000596). A weaker similarity is seen to the H.pylori anticodon nuclease masking agent (prrB) (AE000591). No similarity to T.pallidum, C.trachomatis, or M.genitalium.


COGS Summary:  COGS Search
The phylogenetic pattern of COG0734 is -h-P---U.
Cog name: Restriction endonuclease S subunits.
Functional class: L.
BeTs to -h-p---u.
Number of proteins in this genome belonging to this COG is 3



Blocks Summary:  Blocks Search
None.

ProDom Summary:  Protein Domain Search
Residues 131-232 are 50% similar to an S subunit domain of O25519_XXXXX.

Paralogs:  Local Blast Search
UU096 is paralogously related to UU097 and UU099, two other predicted hsdS proteins: residues 137-224 are 58% similar to UU097 and residues 18-226 are 34% similar to UU099.

Pfam Summary:  Pfam Search
Residues 28 to 194 (E-value = 3.2e-07) place UU096 in the Methylase_S family which is described as Type I restriction modification DNA specificity domain (PF01420)

Structural Feature(s):
Feature Type  Start  Stop
non-globular  
54  
156

PDB Hit:


Gene Protein Sequence:
YSTRERELSRDYIWTLKNIYEKLVQNNVKYKKLWEIVNFDKKFKGVPKEK
QNEILSFKHISANELKRYEKCNFGNVKLLSTGLYDGYIKYNENDNNINYG
EIIALPSGGSPIIKYYNGYFIDSLNIIFSQKNKKECNLKFIYYFLIANKM
LIEENYRGASVKHPNMIEIIELLIPIPHISIQNKIVEILDKLEAYTKDIG
VGLPFEIKQRKKQYEYYRNKLLDFKKY$

Gene Nucleotide Sequence:  Sequence Viewer
TATAGCACGAGAGAGAGAGAGCTAAGTAGGGATTACATTTGAACATTAAA
GAATATATATGAAAAATTAGTTCAAAACAATGTTAAATATAAAAAACTTT
GAGAAATAGTTAATTTTGACAAAAAATTTAAAGGAGTTCCAAAAGAAAAA
CAAAATGAAATATTGTCATTTAAGCATATATCTGCAAACGAATTAAAACG
ATATGAAAAGTGTAATTTTGGTAATGTTAAACTTCTTTCAACAGGATTGT
ATGATGGATATATAAAATATAATGAAAATGATAATAATATTAATTATGGC
GAAATAATTGCTTTGCCATCTGGTGGTTCTCCAATAATAAAATACTATAA
TGGTTATTTCATAGATAGTTTAAATATAATTTTTTCACAAAAAAACAAAA
AAGAATGTAATTTAAAATTTATTTACTATTTTTTGATAGCAAATAAAATG
CTTATTGAAGAAAATTATCGTGGTGCATCTGTAAAACATCCAAACATGAT
AGAGATTATTGAATTATTAATTCCTATCCCTCACATTTCAATCCAAAATA
AAATTGTTGAAATCCTAGATAAATTAGAAGCATATACAAAAGATATTGGC
GTAGGATTACCTTTTGAAATCAAACAACGCAAAAAACAATATGAATACTA
TCGAAATAAATTATTAGATTTTAAAAAATATTAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy