Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Ureaplasma urealyticum Search Results

Record: 1 of 1  
MiniMap IGR84 IGR82 IGR83 IGR85 IGR81 hsdS, - UU096 hsdR, - UU095 hsdM, - UU100 hsdS, - UU099 hsdM, - UU098 UU094 hsdS, - UU096 hsdR, - UU095 hsdM, - UU100 hsdS, - UU099 hsdM, - UU098 UU094 Type: tandem, Name:  - 69 Type: tandem, Name:  - 379 Type: tandem, Name:  - 439 hsdS, - UU096 hsdR, - UU095 hsdS, - UU097 hsdS, - UU097 hsdM, - UU100 hsdS, - UU099 hsdM, - UU098 UU094
* Calculated from Protein Sequence

Gene ID: UU095

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
hsdR  

Definition:
type I restriction enzyme R protein

Gene Start:
123295

Gene Stop:
120158

Gene Length:
3138

Molecular Weight*:
122103

pI*:
7.80

Net Charge*:
4.71

EC:
3.1.21.3  

Functional Class:
replication; DNA replication, restriction, modification, recombination, and repair  

Pathway: pathway table

Comment:
Note that UU095 and UU096 are both similar to H.pylori hsdR and hsdS proteins.

See UU096, a predicted hsdS sequence; UU097, a predicted hsdS sequence; UU098, a predicted hsdM sequence; UU099, a predicted hsdS sequence; and UU100, a predicted hsdM sequence.


Blast Summary:  PSI-Blast Search
Several hits in gapped BLAST to type I restriction enzyme R proteins, e.g. residues 15-1043 are 45% similar to the enzyme from H. pylori (AE000595). Residues 7-1014 are 36% similar to T1R1_ECOLI.
No similarity to T.pallidum, C.trachomatis, or M.genitalium.

COGS Summary:  COGS Search
The phylogenetic pattern of COG0610 is EH-P-MyU.
Cog name: Restriction enzymes type I helicase subunits and related helicases.
Functional class: L.
BeTs to -h-p-m-u.
Number of proteins in this genome belonging to this COG is 4



Blocks Summary:  Blocks Search
Residues 641-658 and 978-998 are similar to blocks PR01004C, G, concerned with flagellar FLIJ proteins, e.g. FLIJ_ECOLI.


ProDom Summary:  Protein Domain Search
Residues 134-217, 242-438, 528-838 are 62%, 59%, and 45% similar to HSDR domains represented by 025517_XXXXX.

Paralogs:  Local Blast Search
No strong evidence of paralogs in U.u.

Pfam Summary:  Pfam Search
Residues 29 to 220 (E-value = 8.7e-57) place UU095 in the HSDR_N family which is described as Type I restriction enzyme R protein N terminus (HSDR_N) (PF04313)
Residues 275 to 484 (E-value = 8.6e-05) place UU095 in the DEAD family which is described as DEAD/DEAH box helicase (PF00270)

Structural Feature(s):
Feature Type  Start  Stop
non-globular  
87  
273
coil-coil  
364  
391
non-globular  
568  
700
non-globular  
736  
1045

PDB Hit:


Gene Protein Sequence:
MENKVLLAEHENSTVVAEFKSIKVHSNKFESEAELEETFIKLLIAQGYEY
LPIKNNNDLKNNLRKQIEKLNNYQFTNNEWESFLSTYLLNPNDGIEARSK
KIHEDYSYPLKKDKDSITKNIKIIDKNNIHNNSIQVINQYQNNNLDNQQK
TRYDVSILINGLPLVHIELKRRGTNLKEAFNQIKRYANHSFTDLYLYTQI
YVISNGTQTKYYSNTTRETSIKERNNTNSKKTSNSFEFTSYWADSKNNQI
LDLIDFCQTFFAKHTILNILTKYCVFTSDNTLMVLRPYQIVATERIINRI
KISLNDKKLLGTTGAGGYIWHTTGSGKTLTSFKTAALAKEIEGVDKVLFV
VDRKDLDYQTTKEYEKYSKGCVSANTNVNELAKQIGNQENKIIITTIQKL
GIFISKNPKHPIYSKNVVLVFDECHRSQFGDLHKKITKKSFKKYMIFGFT
GTPILEENSNVKNKNIFFTTEHLFGACLHKYTIDKAIRDGNVLGFRTEYY
KTLSEKDDIDDETSSTGIDKKEALENPIRISEIVDFILKNYNRLTKRNEE
FFEHNKIANINEVITSRNKLSENKVLTTLNGFNSILACSSINAAKIYYSE
FKKQQQKFPQEEKLKIGLIYSYLPSEQESNDNELSNFELLDENNENTNQL
DLDSRNFLDEAIKDYNEMFGTSYSTDNANFNNYYKDFSLRLKDRSLDIAI
VVNMFLTGFDATTLNTLWLDKKLKYHSLIQAMSRTNRILNGVKSNGNIVF
FINLEDEVNEALRLFSSESNINSSIAILRSFKEYYEGYYNEDNQYIQGYR
NLVEELKSNFKIPFNGTKEEERIFIKLFGDILKYKNLLSQFSEFEQNDDL
IGTEMQDYQSIYIGLRDKYQDKKRMETDSIVSDLDFKIELISQQDIGVDY
ILKLMNEKLKKDLKEVKYHDLERDILSSLKARKKKDLIIEFVNEINKLPN
KDEIDIFNEWSKFIKNKKESELIKIINENKLDNKKTFEFMKKAFENNEFN
ENGVDIVNLMPPTSFFKKSNQNSNRSKIKENATEKLLEYFEKFRG$

Gene Nucleotide Sequence:  Sequence Viewer
ATGGAAAATAAGGTACTATTAGCAGAACATGAAAATTCAACGGTTGTTGC
TGAATTTAAATCAATTAAAGTTCATTCGAATAAATTTGAAAGTGAAGCTG
AATTAGAAGAAACATTTATTAAATTATTAATTGCACAAGGTTATGAATAC
TTACCTATTAAAAATAATAATGATTTAAAAAATAATTTAAGAAAACAAAT
CGAAAAACTTAATAATTATCAATTTACTAATAATGAATGAGAATCTTTTT
TAAGTACTTATTTATTAAATCCTAATGATGGAATTGAAGCAAGATCAAAA
AAAATTCATGAAGATTATAGCTACCCTTTAAAAAAAGATAAAGATAGTAT
CACCAAAAATATAAAGATAATTGATAAAAATAATATTCATAATAATTCTA
TTCAAGTTATTAATCAATATCAAAATAACAATTTAGATAATCAACAAAAA
ACACGATATGATGTGTCTATTTTGATTAATGGACTTCCATTAGTACATAT
TGAACTAAAAAGACGAGGAACTAATCTTAAAGAAGCTTTTAATCAAATTA
AAAGATATGCAAATCATTCGTTTACAGATTTATATCTTTACACGCAAATT
TATGTTATTTCTAATGGTACACAAACTAAATATTATTCAAATACAACTAG
AGAAACTTCTATAAAAGAAAGAAATAATACAAACTCTAAAAAAACAAGTA
ATTCTTTTGAATTTACATCATACTGAGCTGATTCAAAAAATAATCAAATT
CTTGATTTAATCGATTTTTGTCAGACCTTTTTTGCTAAACATACTATTTT
AAATATTTTGACAAAATATTGTGTTTTTACAAGCGATAATACGTTAATGG
TTTTAAGACCATACCAAATTGTTGCAACTGAAAGAATTATTAATCGAATT
AAGATTTCTTTAAATGATAAAAAATTATTAGGAACTACAGGCGCTGGTGG
TTATATTTGACACACAACAGGAAGCGGAAAAACTCTTACATCATTTAAAA
CTGCCGCTTTAGCAAAAGAAATTGAAGGTGTGGATAAGGTTCTATTTGTT
GTTGATCGAAAAGATTTAGACTATCAAACAACAAAAGAATATGAAAAGTA
TTCTAAAGGATGTGTTAGTGCTAATACAAATGTTAATGAACTAGCTAAGC
AAATTGGAAATCAAGAGAATAAAATTATTATTACAACCATTCAAAAACTT
GGCATATTCATTAGTAAAAATCCAAAACATCCTATTTATTCTAAAAATGT
TGTTCTTGTTTTTGATGAATGTCATCGTTCTCAATTTGGTGATTTACATA
AAAAAATTACTAAAAAATCTTTTAAAAAATATATGATTTTTGGGTTTACA
GGCACACCTATTTTAGAAGAAAATAGTAATGTCAAAAATAAAAATATTTT
CTTTACAACAGAGCATCTTTTTGGAGCTTGTTTACATAAATATACAATTG
ATAAAGCTATTCGTGATGGTAATGTTTTAGGTTTTAGAACGGAGTATTAT
AAAACACTTAGCGAAAAAGATGACATTGACGATGAAACATCATCAACTGG
AATAGATAAAAAAGAAGCTTTGGAAAATCCGATTCGTATTTCTGAAATTG
TTGATTTTATTTTAAAAAACTATAATCGTTTAACCAAAAGAAATGAAGAA
TTTTTTGAACATAATAAGATTGCTAATATAAATGAAGTTATTACTAGCAG
AAATAAATTAAGCGAAAATAAAGTATTAACAACACTAAATGGATTTAATT
CTATTCTAGCTTGCTCTTCTATTAATGCAGCTAAAATATATTATTCAGAA
TTTAAAAAACAACAACAAAAATTTCCTCAAGAAGAAAAATTAAAAATTGG
ATTAATTTATAGTTATTTACCAAGCGAACAAGAAAGTAATGATAATGAAC
TTTCTAATTTTGAACTATTAGATGAGAATAACGAAAACACTAATCAACTT
GATTTAGATTCACGTAATTTTCTTGATGAAGCGATTAAAGATTATAATGA
AATGTTTGGGACATCATACTCAACAGATAATGCTAATTTTAATAATTACT
ATAAAGACTTTAGCTTGAGATTAAAGGATCGAAGCTTAGATATAGCAATC
GTTGTTAATATGTTTTTAACAGGTTTTGATGCAACAACTTTAAATACATT
ATGATTGGACAAAAAACTAAAATATCATAGTTTAATTCAAGCAATGTCGC
GAACCAATCGAATTCTTAATGGTGTTAAATCAAATGGTAATATTGTCTTT
TTCATAAATTTAGAAGATGAAGTGAATGAAGCTTTAAGATTATTTTCATC
AGAGAGCAATATTAATTCTTCGATCGCTATTTTAAGATCATTTAAAGAAT
ATTATGAAGGATATTATAATGAAGATAATCAATATATACAAGGTTATCGA
AACTTAGTAGAAGAATTAAAAAGTAACTTTAAAATTCCTTTTAATGGAAC
AAAAGAAGAGGAAAGAATTTTTATTAAACTTTTTGGTGATATTTTAAAAT
ATAAAAATTTGCTTTCACAATTTAGTGAATTTGAACAAAACGATGATCTT
ATTGGTACAGAAATGCAAGATTATCAAAGTATATATATCGGGTTGCGTGA
TAAATATCAAGATAAAAAACGTATGGAAACAGATAGCATTGTTAGTGATC
TTGATTTTAAAATTGAATTAATTAGTCAACAAGATATTGGTGTTGATTAT
ATTCTTAAGTTAATGAATGAAAAGCTCAAAAAAGATCTAAAAGAAGTTAA
ATATCACGATCTAGAAAGAGATATTTTATCTAGTCTAAAAGCGCGAAAAA
AGAAAGATTTAATTATTGAATTTGTTAATGAAATTAATAAACTACCTAAT
AAGGATGAAATTGATATTTTTAATGAATGGAGTAAGTTTATTAAAAATAA
AAAAGAAAGTGAGCTTATAAAAATAATTAATGAAAATAAATTAGATAACA
AAAAAACATTTGAATTTATGAAAAAAGCATTTGAAAATAATGAATTTAAT
GAAAATGGAGTAGATATTGTTAATTTAATGCCTCCTACCTCTTTTTTTAA
AAAAAGTAATCAGAATAGTAATAGGTCTAAAATAAAAGAAAATGCTACTG
AAAAATTACTCGAATATTTTGAAAAATTCCGTGGTTAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy