Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Ureaplasma urealyticum Search Results

Record: 1 of 1  
MiniMap IGR74 IGR75 IGR71 IGR70 IGR77 IGR76 IGR69 IGR73 IGR72 IGR78 UU086 UU089.1 UU088 UU083 recR, - UU089 recA, - UU084 ffh, - UU091 UU085 UU090 dnaX, - UU087 UU086 UU089.1 UU088 UU083 recR, - UU089 recA, - UU084 ffh, - UU091 UU085 UU090 dnaX, - UU087 Type: tandem, Name:  - 59 Type: tandem, Name:  - 64 Type: tandem, Name:  - 67 Type: tandem, Name:  - 58 Type: tandem, Name:  - 62 Type: tandem, Name:  - 397 Type: tandem, Name:  - 56 Type: tandem, Name:  - 66 Type: tandem, Name:  - 63 Type: tandem, Name:  - 61 Type: tandem, Name:  - 57 Type: tandem, Name:  - 65 Type: tandem, Name:  - 60 UU086 UU088 UU083 recR, - UU089 recA, - UU084 ffh, - UU091 UU085 UU090 dnaX, - UU087 UU089.1
* Calculated from Protein Sequence

Gene ID: UU087

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
dnaX  

Definition:
DNA polymerase III gamma-tau subunits

Gene Start:
105760

Gene Stop:
107553

Gene Length:
1794

Molecular Weight*:
69029

pI*:
6.30

Net Charge*:
-3.06

EC:
2.7.7.7  

Functional Class:
replication; DNA replication, restriction, modification, recombination, and repair  

Pathway: pathway table
Purine metabolism
Pyrimidine metabolism

Comment:
UU019 is a predicted delta coding sequence. UU377 and UU415 appear to be
alpha subunits.

The complete list of dna() genes in U.u. are: UU001, a predicted dnaA sequence; UU019, a predicted dnaH sequence; UU079, a predicted dnaN sequence; UU087, a predicted dnaX sequence; UU339, a predicted dnaK sequence; UU407, a predicted dnaJ sequence; UU415, a predicted dnaE sequence; UU494, a predicted dnaG sequence; and UU550, a predicted dnaB sequence.

Blast Summary:  PSI-Blast Search
Numerous hits in gapped BLAST to dnaX sequences, e.g. residues 9-449 are 34% similar to the enzyme from B. burgdorferi (AE001151). Most other similarities are limited to the first 300 residues. UU087 is similar to MG420, TP1005 and CT334, all predicted dnaX protein sequences.

COGS Summary:  COGS Search
The phylogenetic pattern of COG0470 is EHGPCMYU.
Cog name: ATPases and helicase subunits involved in DNA replication.
Functional class: L.
BeTs to -h-pcmyu.
Number of proteins in this genome belonging to this COG is 5



Blocks Summary:  Blocks Search
Residues 4-55 are similar to block PR00819B, seen in CBXX/CFQX superfamily proteins.





ProDom Summary:  Protein Domain Search
Numerous regions in the sequence show similarity to ATP domains, e.g. residues 156-244 are 47% similar to DP3X_MYCPN.

Paralogs:  Local Blast Search
UU087 is weakly similar to UU019, a predicted pol III delta sequence, and to numerous ABC transporter sequences of U.u.



Pfam Summary:  Pfam Search
Residues 40 to 230 (E-value = 2.4e-06) place UU087 in the AAA family which is described as ATPase family associated with various cellular activities (AAA) (PF00004)

Structural Feature(s):
Feature Type  Start  Stop
non-globular  
165  
419
coil-coil  
420  
479
coil-coil  
549  
597

PDB Hit:
gi|3212391|pdb|1A5T| Crystal Structure Of The Delta Prime Subunit Of The Clamp-Loader Complex Of Escherichia Coli Dna Polymerase Iii

Gene Protein Sequence:
MSESTLYRKYRPHKFKNVIGQDLIKQALMNACLNNKITHAYIFSGPRGIG
KTSIARIFASSINCLNPNKGDCCGKCSVCESILKEQSVDLIELDAASNNG
VDQIRIITDNINYLPTFFKYKVYIIDEAHMLSTSAWNALLKTVEEPPQHV
IFIFATTEYQKIPLTIISRCQRYDFKRLNNSELQELIDSILTKEDIKIDN
NAIDKLIQLADGSGRDCLSILDQLTTVKKNIDLDLINKTFGLVDNFKVIS
LIELIQKNDILLLREFIYELYNQGVNLEAFCVQIINVLIDYLIYLKTNDI
NNLKKVSVDELKKMLLINFNGNYLLNNFISLFNNLKKSLNQVFEFEIYLY
KIINANNDKLENKKIELSINPEENKINNSQIITTKKIDCFEEINKNTVDF
DKLYKTKIFYHKKINNQNDKESGINQKEELSTELVNDNKLICNSNDILDN
YELAKQAFFNKDIKLSKEMSQKFKDFKNEETIENSYIDIIKQADLVLWCS
PNALVLGVEFLGLINRINKVTHSFEFIKEFVKKFDSIKLVIAISKKQALN
IINIKKQGLKTNIINDVLIDDIKMLLKQEEQRKQEQTALLNEIEDEE$

Gene Nucleotide Sequence:  Sequence Viewer
ATGAGCGAATCAACATTGTACCGTAAATATCGGCCACATAAATTTAAAAA
TGTAATAGGTCAAGATTTAATTAAACAAGCATTAATGAATGCTTGTTTAA
ACAACAAAATTACACATGCTTATATTTTTAGTGGACCACGAGGAATTGGA
AAAACATCAATAGCTAGAATTTTTGCGTCTAGTATTAATTGTTTAAATCC
TAATAAAGGTGATTGTTGCGGCAAATGTAGTGTTTGTGAAAGTATTCTCA
AAGAACAAAGTGTTGATTTGATTGAATTAGATGCTGCTAGTAATAATGGT
GTTGATCAAATACGTATTATTACTGATAATATAAATTATTTACCAACATT
TTTTAAGTATAAAGTCTATATTATTGATGAAGCACATATGCTATCTACAT
CAGCATGAAATGCTTTATTAAAAACAGTTGAAGAACCACCACAACACGTT
ATTTTTATTTTTGCAACAACAGAGTACCAAAAAATTCCCTTAACAATTAT
TAGTCGTTGCCAACGTTATGATTTTAAGCGTTTAAATAACAGTGAATTAC
AAGAATTAATAGACTCTATCCTTACAAAAGAAGATATCAAAATTGATAAT
AATGCAATTGATAAATTAATTCAATTAGCTGATGGATCTGGGCGTGATTG
TTTAAGCATTTTAGATCAATTAACAACGGTTAAAAAAAATATAGATCTTG
ATTTAATAAATAAAACTTTTGGTTTAGTTGACAACTTTAAAGTAATTTCT
TTAATCGAATTAATTCAAAAAAACGACATTTTATTATTGCGTGAATTTAT
TTATGAATTATACAATCAAGGTGTTAATTTAGAAGCTTTTTGTGTGCAAA
TAATAAATGTTTTAATTGATTATTTAATTTATTTAAAAACAAACGATATA
AATAATCTTAAAAAAGTATCAGTTGATGAATTAAAAAAAATGTTATTAAT
TAATTTTAATGGTAATTATTTGTTAAATAATTTTATTTCTTTATTTAATA
ATTTAAAAAAATCATTAAATCAAGTTTTTGAATTTGAAATTTATTTATAT
AAAATAATCAATGCTAATAATGATAAATTAGAAAATAAAAAAATAGAATT
GTCAATTAACCCTGAAGAAAATAAAATTAATAATTCCCAAATAATAACGA
CAAAAAAAATCGATTGTTTTGAAGAAATAAATAAAAATACTGTTGATTTT
GATAAGTTATACAAAACAAAAATTTTTTATCACAAAAAAATTAACAACCA
GAATGATAAAGAATCAGGTATTAATCAAAAAGAAGAATTAAGTACAGAAT
TAGTTAATGATAATAAATTGATTTGCAATTCTAATGATATATTAGATAAT
TATGAACTAGCCAAACAAGCTTTTTTTAATAAAGACATTAAACTTTCAAA
AGAAATGAGTCAAAAATTTAAAGATTTTAAAAATGAAGAAACCATTGAAA
ATAGTTATATTGATATTATTAAACAAGCTGATTTAGTACTTTGGTGCTCA
CCTAATGCACTAGTTTTAGGAGTAGAGTTTTTAGGATTAATTAATCGTAT
CAATAAAGTTACGCATTCATTTGAATTTATTAAAGAATTTGTTAAGAAAT
TTGATTCTATCAAGTTAGTTATTGCTATTAGCAAAAAACAAGCATTAAAT
ATTATTAATATTAAAAAACAAGGTTTAAAAACTAATATAATTAATGATGT
TTTAATTGATGATATTAAAATGTTATTAAAACAAGAAGAACAACGAAAAC
AAGAACAAACAGCGTTATTAAATGAAATTGAAGATGAGGAGTAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy