Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Ureaplasma urealyticum Search Results

Record: 1 of 1  
MiniMap IGR74 IGR75 IGR71 IGR70 IGR77 IGR76 IGR69 IGR73 IGR72 UU086 UU089.1 UU088 UU083 recR, - UU089 recA, - UU084 UU085 UU090 dnaX, - UU087 parC,gyrA, - UU082 UU086 UU089.1 UU088 UU083 recR, - UU089 recA, - UU084 UU085 UU090 dnaX, - UU087 parC,gyrA, - UU082 Type: tandem, Name:  - 59 Type: tandem, Name:  - 64 Type: tandem, Name:  - 58 Type: tandem, Name:  - 62 Type: tandem, Name:  - 56 Type: tandem, Name:  - 63 Type: tandem, Name:  - 61 Type: tandem, Name:  - 57 Type: tandem, Name:  - 65 Type: tandem, Name:  - 60 UU086 UU088 UU083 recR, - UU089 recA, - UU084 UU085 UU090 dnaX, - UU087 parC,gyrA, - UU082 UU089.1
* Calculated from Protein Sequence

Gene ID: UU086

DNA Molecule Name:
1  

Genbank ID:


Gene Name:


Definition:
deoxypurine kinase subunit

Gene Start:
105562

Gene Stop:
104864

Gene Length:
699

Molecular Weight*:
27325

pI*:
6.80

Net Charge*:
-0.41

EC:
2.7.1.113  2.7.1.76  

Functional Class:
purines, pyrimidines, nucleosides, and nucleotides  

Pathway: pathway table
Purine metabolism

Comment:
In lactobacillis, the deoxypurine kinase is a heterodimer.

University of Alabama: deoxyguanosine kinase

Blast Summary:  PSI-Blast Search
UU086 is similar in gapped BLAST to MG268, a conserved hypothetical protein that may
be a deoxypurine kinase subunit: residues 11-227 are 56% similar to
this protein. Other similarities are to Y268_MYCPN, DGK2_LACAC, a
predicted deoxypurine kinase and some bacterial hypotheticals. No
similarities to T.pallidum or C.trachomatis.



COGS Summary:  COGS Search
None.

Blocks Summary:  Blocks Search
None.

ProDom Summary:  Protein Domain Search
As with BLAST results, residues 11-224 are 56% similar to Y268_MYCPN.
Residues 80-219 are 28% similar to a kinase transferase domain as seen
in YAAF_BACSU.

Paralogs:  Local Blast Search
No paralogs in U.u.

Pfam Summary:  Pfam Search
No significant hits to the Pfam 11.0 database

Structural Feature(s):
Feature Type  Start  Stop
coil-coil  
202  
232

PDB Hit:


Gene Protein Sequence:
MSDKKLDFLTPSFKKNRVSNSIAIGGMIAFGKSTLAQALHEKYQPSNVVY
EMVEGDKLMDLLLAKMYERENNVLFGSLFQLYFVLNRFANYKNNCNRKSL
TIFDRSIFEDWLFAHANIDKPSVFSYYDGLWQGVCKELIYEHGVPKLYVI
LDGDWELFKERIFKRNRKVEIDNFSINETYFKRLLEMYKNYMVNVCKDFG
INYVVLDANNSVEQNVDEVTKILQKLENEQDK$

Gene Nucleotide Sequence:  Sequence Viewer
ATGTCAGATAAAAAATTAGATTTTTTAACACCATCTTTTAAAAAAAATAG
GGTTTCTAATTCTATTGCAATAGGTGGTATGATTGCTTTTGGTAAATCTA
CTTTAGCACAAGCTTTACACGAAAAATATCAACCATCAAATGTGGTTTAT
GAAATGGTTGAGGGTGATAAATTAATGGATTTATTACTAGCAAAAATGTA
TGAACGTGAGAATAACGTTCTTTTTGGGTCTTTATTTCAACTATATTTTG
TTTTAAATCGTTTTGCAAACTACAAAAATAATTGTAACCGTAAAAGTTTA
ACAATTTTTGATCGTAGTATTTTTGAAGATTGATTATTTGCGCATGCAAA
TATTGATAAACCTTCTGTATTTTCATATTATGATGGATTGTGACAAGGAG
TTTGCAAAGAATTAATCTATGAACATGGAGTTCCAAAACTTTACGTCATT
TTAGATGGTGATTGAGAGTTATTCAAAGAAAGAATTTTTAAAAGAAACCG
GAAAGTTGAAATTGATAATTTTTCAATTAATGAAACATACTTCAAACGTT
TATTAGAAATGTACAAAAATTATATGGTTAATGTTTGTAAAGATTTTGGT
ATTAACTATGTTGTTTTAGATGCAAACAATTCTGTTGAACAAAACGTTGA
TGAAGTTACAAAAATATTACAAAAGTTAGAAAATGAGCAAGACAAATAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy