Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Ureaplasma urealyticum Search Results

Record: 1 of 1  
MiniMap IGR67 IGR68 IGR71 IGR70 IGR69 IGR66 IGR72 IGR65 pth, - UU078 UU086 UU080 UU083 recA, - UU084 dnaN, - UU079 UU085 parE,gyrB, - UU081 parC,gyrA, - UU082 pth, - UU078 UU086 UU080 UU083 recA, - UU084 dnaN, - UU079 UU085 parE,gyrB, - UU081 parC,gyrA, - UU082 Type: tandem, Name:  - 56 Type: tandem, Name:  - 396 Type: tandem, Name:  - 55 Type: tandem, Name:  - 59 Type: tandem, Name:  - 53 Type: tandem, Name:  - 395 Type: tandem, Name:  - 58 Type: tandem, Name:  - 54 Type: tandem, Name:  - 57 pth, - UU078 UU086 UU080 UU083 recA, - UU084 dnaN, - UU079 UU085 parE,gyrB, - UU081 parC,gyrA, - UU082
* Calculated from Protein Sequence

Gene ID: UU082

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
parC  gyrA  

Definition:
DNA topoisomerase subunit A (gyrase A)

Gene Start:
99069

Gene Stop:
101591

Gene Length:
2523

Molecular Weight*:
94247

pI*:
6.40

Net Charge*:
-4.85

EC:
5.99.1.3  

Functional Class:
replication; DNA replication, restriction, modification, recombination, and repair  

Pathway: pathway table

Comment:
Two A chains and two B chains (UU081) make up the complete gyrase molecule. The B chain of DNA gyrase is said to perform an ATP hydrolyzing function.

The four predicted gyrase genes in U.u. are: UU081 (gyrB), UU082 (gyrA), UU466 (gyrB), and UU467 (gyrA).

Blast Summary:  PSI-Blast Search
Numerous hits in gapped BLAST to gyrase subunit A sequences, e.g residues 23-834 are 55% similar to GYRA_BACS5. UU082 is also similar to MG004, TP0005, CT189 and CT660, predicted gyrase subunit A sequences. It is similar to MG204, a predicted parC sequence.

COGS Summary:  COGS Search
The phylogenetic pattern of COG0188 is EHGPC-yu.
Cog name: DNA gyrase and topoisomerase IV A subunits.
Functional class: L.
BeTs to -h-pc-yu.
Number of proteins in this genome belonging to this COG is 2



Blocks Summary:  Blocks Search
Residues 37-694 span nine regions of similarity to blocks PF00521A-G, which encompass DNA gyrase A/topoisomerase sequences, e.g. GYRA_ECOLI, GYRA_MYCGE.

ProDom Summary:  Protein Domain Search
Residues 23-815 span numerous regions of similarity to GYRA domains as observed in GYRA_MYCGE, GYRA_MYCPN, GYRA_STRPN, and others.


Paralogs:  Local Blast Search
UU082 is paralogously related to UU467, a predicted gyrA sequence: residues 34-786 are 34% similar to UU467.


Pfam Summary:  Pfam Search
Residues 49 to 496 (E-value = 2.8e-276) place UU082 in the DNA_topoisoIV family which is described as DNA gyrase/topoisomerase IV, subunit A (PF00521)
Residues 520 to 569 (E-value = 1.4e-14) place UU082 in the DNA_gyraseA_C family which is described as DNA gyrase C-terminal domain, beta-propeller (PF03989)
Residues 570 to 622 (E-value = 3.5e-12) place UU082 in the DNA_gyraseA_C family which is described as DNA gyrase C-terminal domain, beta-propeller (PF03989)
Residues 625 to 672 (E-value = 1.5e-10) place UU082 in the DNA_gyraseA_C family which is described as DNA gyrase C-terminal domain, beta-propeller (PF03989)
Residues 673 to 722 (E-value = 8e-12) place UU082 in the DNA_gyraseA_C family which is described as DNA gyrase C-terminal domain, beta-propeller (PF03989)
Residues 723 to 773 (E-value = 8.6e-11) place UU082 in the DNA_gyraseA_C family which is described as DNA gyrase C-terminal domain, beta-propeller (PF03989)
Residues 774 to 823 (E-value = 1.6e-13) place UU082 in the DNA_gyraseA_C family which is described as DNA gyrase C-terminal domain, beta-propeller (PF03989)

Structural Feature(s):
Feature Type  Start  Stop
non-globular  
275  
369
coil-coil  
438  
494
non-globular  
689  
840

PDB Hit:
gi|3891992|pdb|1AB4| 59kda Fragment Of Gyrase A From E. Coli

Gene Protein Sequence:
MALKKPKKSRLTTEEIKQQLEGSTIKEQSITKEVETSFLDYSMSVIVARA
LPDVRDGFKPVHRRALFAAFENGMTHDKPYKKSARWVGDVIGKYHPHGDQ
AVYQTIVRMAQDFSMRYLLVDGHGNFGSIDGDSAAAMRYTEARLSKISYE
LLKYIDKETVDFVPNYDASEQEPSVLPSGFPNLLTNGTTGIAVGMATNIP
PHNLTEVCQAIKAYAKNHNVTISEIMEYLKGPDFPTGAEIYGDSGIIKYF
NTGRGSVTIRSKYEIEDIGQGRVAIVVTEIPYMVNKANLIEKIVELVTNK
QIEGISDLRDESSRDGIRIVIEVKRDVIPEVLLNKLFKTTPLQTNFSVNN
LALVNGVPMVLNIKEMIKYYFEHQIEILVRRTNFDLKKAKERIHIVEGLV
IAVNNIDEVIKIIKASGDDDIASKSLIQRFDLTELQTKAILEMRLRALTG
LNIDKLKKEYEDLILVIKDLEDVLNNYNRQVNIICENLDYLIEKFGDERR
TEIMYGVSSHIDDEDLIPVEDIVVTMSKRGYFKRLPIDTYKNQRRGGVGV
QGLKTYEDDDVEKILVANTHTDLLFFSDLGRVYRLRGHEVPLGSRQSKGI
PAINFLPIEKSESILTILPIDNYDQGSLFFTTSKGIIKRANLSDFESIRA
NGKIAITLKDGDKLFSVMQTLGNDEVFIGASNGNVIRFNENDAREMGRIA
TGVKGINLENDEYVVGTGLSSHGEYVLAVGSKGLGKLTDINDYRLTKRGA
KGVNTLKVNDKTGNLVSIKVVNREEEALIITTSGKVIRLSIKDISVIGRN
TSGVKLISLENKEEVKSIAIFKKEEINDEQLLQENDYNLK$

Gene Nucleotide Sequence:  Sequence Viewer
ATGGCATTAAAAAAACCAAAAAAAAGTCGTTTAACCACCGAAGAAATTAA
GCAACAATTAGAAGGTTCAACGATTAAAGAACAATCAATTACAAAAGAAG
TCGAAACATCATTTTTAGATTATTCAATGTCTGTAATCGTTGCACGTGCT
TTGCCTGATGTGCGTGATGGATTTAAGCCCGTGCATCGCCGAGCTTTATT
TGCTGCTTTCGAAAACGGAATGACACATGATAAGCCTTATAAAAAATCTG
CACGTTGAGTTGGGGATGTAATTGGAAAATATCATCCACATGGAGATCAA
GCTGTTTATCAAACTATTGTAAGAATGGCACAAGACTTTTCAATGCGTTA
TTTATTAGTTGATGGTCATGGTAATTTTGGTTCGATTGATGGTGATAGTG
CAGCTGCGATGCGTTATACAGAAGCACGATTATCAAAAATCTCTTATGAA
TTATTAAAATACATTGATAAAGAAACAGTAGATTTTGTACCTAATTATGA
TGCATCAGAACAAGAACCAAGTGTTTTACCATCAGGTTTTCCAAATTTAT
TAACAAATGGAACTACAGGAATAGCTGTTGGGATGGCAACAAATATTCCA
CCACATAATTTAACTGAAGTTTGTCAAGCAATAAAAGCTTATGCTAAAAA
CCATAATGTTACTATTTCTGAAATTATGGAATATCTAAAAGGTCCTGATT
TTCCAACAGGCGCTGAAATTTATGGTGATAGCGGTATTATTAAATATTTT
AATACAGGTCGTGGTTCAGTAACAATTCGTTCAAAATATGAAATTGAAGA
TATTGGGCAAGGACGTGTAGCAATTGTTGTGACAGAAATTCCTTATATGG
TTAATAAAGCTAATTTAATTGAAAAAATTGTTGAATTAGTAACAAACAAA
CAAATCGAAGGAATTTCTGATTTACGTGACGAGTCAAGTCGTGATGGAAT
TCGAATTGTTATTGAAGTTAAACGTGATGTTATACCTGAAGTTTTATTAA
ACAAATTATTTAAAACAACACCTTTACAAACAAATTTTAGTGTTAATAAT
TTAGCTTTAGTTAATGGTGTACCAATGGTATTAAACATTAAGGAAATGAT
TAAATACTATTTTGAACACCAAATTGAGATTTTAGTAAGAAGAACAAATT
TTGATTTAAAAAAAGCAAAAGAACGAATTCATATTGTTGAAGGTTTAGTA
ATTGCTGTTAATAATATCGATGAAGTAATTAAAATTATTAAAGCCTCAGG
TGATGATGATATTGCTTCAAAATCACTAATTCAACGTTTCGATTTAACAG
AATTGCAAACGAAAGCAATTTTAGAAATGCGTTTACGCGCTTTAACAGGA
CTAAATATTGATAAATTAAAAAAAGAATATGAAGATTTAATATTAGTTAT
TAAAGATTTAGAAGATGTTTTAAACAACTACAATCGTCAAGTTAATATTA
TTTGTGAAAATTTAGATTATTTAATTGAAAAATTTGGTGATGAGCGTCGT
ACAGAAATTATGTATGGAGTTAGTTCGCATATTGATGATGAAGATTTAAT
ACCAGTCGAAGATATTGTTGTAACAATGTCAAAACGTGGTTATTTTAAAC
GTTTGCCAATTGATACATATAAAAATCAACGACGTGGTGGTGTAGGTGTA
CAAGGATTAAAAACGTATGAGGATGATGATGTTGAAAAAATCTTAGTTGC
TAATACCCATACAGATTTATTATTCTTTTCTGATTTAGGTCGTGTTTATC
GATTACGAGGACATGAAGTACCATTGGGATCACGACAATCAAAAGGAATT
CCAGCAATTAATTTTTTACCAATTGAAAAAAGTGAAAGCATTTTAACTAT
TTTACCAATAGATAATTATGATCAAGGTTCATTATTCTTTACAACAAGTA
AAGGAATTATAAAACGAGCTAATCTAAGTGATTTCGAGTCAATTCGTGCT
AATGGTAAAATTGCTATTACTTTAAAAGATGGTGATAAATTATTTTCAGT
AATGCAAACACTAGGTAATGATGAAGTATTTATCGGCGCATCAAATGGTA
ATGTAATTCGTTTCAATGAAAATGATGCACGTGAAATGGGAAGAATTGCG
ACAGGTGTTAAAGGAATTAATTTAGAAAATGATGAATATGTTGTAGGAAC
AGGGTTATCTAGTCATGGAGAATATGTTTTAGCTGTTGGTTCTAAAGGAT
TAGGTAAATTAACTGACATCAATGATTATCGTTTAACTAAGCGTGGAGCA
AAAGGTGTTAATACACTAAAAGTAAATGATAAAACAGGTAACTTAGTAAG
TATTAAAGTTGTTAATCGTGAAGAAGAAGCTTTAATTATTACAACTAGTG
GAAAAGTTATTCGTTTATCGATTAAAGACATTAGTGTAATTGGAAGAAAT
ACATCAGGAGTTAAATTAATTTCATTAGAAAATAAAGAAGAAGTAAAATC
AATTGCTATCTTTAAAAAAGAAGAAATTAATGATGAACAATTATTACAAG
AAAATGATTACAATCTAAAATAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy