Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Ureaplasma urealyticum Search Results

Record: 1 of 1  
MiniMap IGR67 IGR64 IGR62 IGR68 IGR66 IGR65 ptsK,hprK, - UU076 trxB, - UU074 UU077 lgt, - UU075 UU080 dnaN, - UU079 parE,gyrB, - UU081 parC,gyrA, - UU082 ptsK,hprK, - UU076 trxB, - UU074 UU077 lgt, - UU075 UU080 dnaN, - UU079 parE,gyrB, - UU081 parC,gyrA, - UU082 Type: tandem, Name:  - 55 Type: tandem, Name:  - 52 Type: tandem, Name:  - 396 Type: tandem, Name:  - 53 Type: tandem, Name:  - 54 Type: tandem, Name:  - 395 ptsK,hprK, - UU076 trxB, - UU074 UU077 lgt, - UU075 pth, - UU078 pth, - UU078 UU080 dnaN, - UU079 parE,gyrB, - UU081 parC,gyrA, - UU082
* Calculated from Protein Sequence

Gene ID: UU079

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
dnaN  

Definition:
DNA polymerase III beta chain

Gene Start:
95588

Gene Stop:
96727

Gene Length:
1140

Molecular Weight*:
43359

pI*:
7.50

Net Charge*:
0.46

EC:
2.7.7.7  

Functional Class:
replication; DNA replication, restriction, modification, recombination, and repair  

Pathway: pathway table
Purine metabolism
Pyrimidine metabolism

Comment:
In addition to its replicative activities, the pol III enzyme has 3' to 5'
exonuclease activity. The alpha chain has the polymerizing activity, while
the epsilon chain has the exonucleolytic activity.

The complete list of dna() genes in U.u. are: UU001, a predicted dnaA sequence; UU019, a predicted dnaH sequence; UU079, a predicted dnaN sequence; UU087, a predicted dnaX sequence; UU339, a predicted dnaK sequence; UU407, a predicted dnaJ sequence; UU415, a predicted dnaE sequence; UU494, a predicted dnaG sequence; and UU550, a predicted dnaB sequence.

Blast Summary:  PSI-Blast Search
Several hits in gapped BLAST to predicted pol III beta chain sequences, e.g.
residues 32 to 379 are 26% similar to DP3B_SPICI. UU079 is weakly similar to MG001
and CT075, both predicted pol III beta subunit sequences. No significant
similarity to T.pallidum.



COGS Summary:  COGS Search
The phylogenetic pattern of COG0592 is ehgpc--u.
Cog name: DNA polymerase III beta subunit.
Functional class: L.
BeTs to -h-pc---.
Number of proteins in this genome belonging to this COG is 1



Blocks Summary:  Blocks Search
Residues 5-357 span six regions of similarity to blocks PF00712A, B,
E and F, concerned with pol III beta chain sequences, e.g. DP3B_SPICI.




ProDom Summary:  Protein Domain Search
Residues 139-378 are 24% similar to a pol III beta chain domain as seen
in DP3B_STAAU. Residues 3-104 are 32% similar to a pol III beta domain
of DP3B_SPICI and 26% similar to DP3B_MYCPN.

Paralogs:  Local Blast Search
No obvious paralogs in U.u., however UU079 is weakly similar to UU073,
a hypothetical (E value 4e-05).

Pfam Summary:  Pfam Search
Residues 1 to 121 (E-value = 3.2e-05) place UU079 in the DNA_pol3_beta family which is described as DNA polymerase III beta subunit, N-terminal domain (PF00712)

Structural Feature(s):
Feature Type  Start  Stop
non-globular  
1  
132

PDB Hit:


Gene Protein Sequence:
MEVFISIKKLIEAIKFSTTIANTNNANALLLGVLIEVSQNKISFKTTNNQ
VSGYKEITEGFEYFNSGKVLVTAKIILGLISKLKDKSVLLKQIDTNILLI
KTENFETQINTMNIEGFPNLNFSLEDYVKISLPHQIMQEINTKVLPNVLN
SQGIEKIQPISGILIDTQTLENKLIAIGTDKIKASCLIREYMGEKFKFIV
SYSTMKLIIEILKNVEYSNNQTVDFYVRSRSLIFKINDAILQTRMIDGVY
PNIYSIFDETNEENTYVFDRRLLIEIIERGMNIVMQEQNPKISIRIDKNE
AEISLTTFEIGNMKEKMSIVNLNNKSAEFILNPSLLAHVLKNFDNNDVTF
KVKDEILRPIIFIDTKDVGFKQILSRIKN$

Gene Nucleotide Sequence:  Sequence Viewer
ATGGAAGTTTTTATTTCTATAAAAAAATTAATTGAAGCAATAAAATTTAG
TACAACAATTGCTAATACAAACAATGCAAATGCTTTATTATTAGGTGTTT
TGATTGAAGTTAGTCAAAATAAAATTAGTTTTAAGACGACAAATAATCAA
GTGAGTGGTTATAAAGAAATTACTGAAGGATTTGAATATTTTAATAGTGG
AAAAGTTTTAGTTACAGCTAAGATTATTTTAGGATTAATTTCTAAGCTTA
AAGATAAATCTGTTTTATTAAAACAAATTGACACAAATATTTTATTAATT
AAAACTGAAAATTTTGAAACTCAAATTAATACAATGAATATTGAAGGCTT
TCCTAATTTAAACTTTAGTTTAGAAGATTACGTTAAAATCAGTTTGCCGC
ATCAAATTATGCAAGAGATTAATACAAAGGTTTTACCCAACGTTTTGAAC
AGTCAAGGAATTGAAAAAATTCAACCGATTTCTGGAATTTTGATTGATAC
TCAAACTTTAGAAAATAAGTTGATTGCTATTGGTACAGATAAAATTAAAG
CTTCATGTTTAATAAGAGAATATATGGGTGAAAAATTTAAATTTATTGTC
TCTTATTCAACAATGAAATTGATTATCGAAATCCTTAAAAATGTTGAATA
TAGTAATAATCAAACTGTTGATTTTTATGTTCGAAGTAGAAGTTTAATTT
TTAAAATTAATGATGCAATTTTACAAACAAGAATGATTGATGGTGTTTAT
CCAAATATTTACTCAATTTTTGATGAAACAAATGAAGAAAATACATATGT
TTTTGATCGTCGTTTATTGATAGAAATTATTGAACGGGGTATGAATATTG
TTATGCAAGAACAAAACCCTAAAATTAGTATTAGAATAGACAAAAATGAA
GCAGAAATCAGTTTAACAACTTTTGAAATTGGTAATATGAAAGAAAAAAT
GTCAATAGTTAATTTAAACAATAAAAGTGCTGAGTTTATTTTAAACCCTA
GTTTGCTAGCTCATGTTTTAAAAAATTTTGATAACAACGATGTAACTTTT
AAAGTTAAAGATGAAATTTTAAGACCTATTATTTTTATCGATACCAAAGA
TGTTGGATTTAAACAGATTTTATCAAGAATAAAAAATTAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy