Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Ureaplasma urealyticum Search Results

Record: 1 of 1  
MiniMap IGR67 IGR64 IGR62 IGR68 IGR66 IGR65 ptsK,hprK, - UU076 UU073 UU077 lgt, - UU075 UU080 dnaN, - UU079 parE,gyrB, - UU081 parC,gyrA, - UU082 ptsK,hprK, - UU076 UU073 UU077 lgt, - UU075 UU080 dnaN, - UU079 parE,gyrB, - UU081 parC,gyrA, - UU082 Type: tandem, Name:  - 54 Type: tandem, Name:  - 51 Type: tandem, Name:  - 395 Type: tandem, Name:  - 52 Type: tandem, Name:  - 53 Type: tandem, Name:  - 55 Type: tandem, Name:  - 396 ptsK,hprK, - UU076 UU073 UU077 lgt, - UU075 pth, - UU078 trxB, - UU074 pth, - UU078 trxB, - UU074 UU080 dnaN, - UU079 parE,gyrB, - UU081 parC,gyrA, - UU082
* Calculated from Protein Sequence

Gene ID: UU078

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
pth  

Definition:
peptidyl-tRNA hydrolase

Gene Start:
95366

Gene Stop:
94806

Gene Length:
561

Molecular Weight*:
20892

pI*:
10.20

Net Charge*:
8.37

EC:
3.1.1.29  

Functional Class:
translation; translation factors  

Pathway: pathway table

Comment:
In other bacteria, pth appears to promote the hydrolysis of peptide chains from tRNAs, perhaps as peptidyl-tRNAs exit ribosomes. See De La Vega et al., Gene 169:97 (1996) and Engel et al., J.Bact. 172:6959 (1990).

See Prosite PDOC00920.

From Prosite: Peptidyl-tRNA hydrolase (EC 3.1.1.29) (PTH) is a bacterial enzyme that cleaves peptidyl-tRNA or N-acyl-aminoacyl-tRNA to yield free peptides or N-acyl-amino acids and tRNA. The natural substrate for this enzyme may be peptidyl-tRNA which drop off the ribosome during protein synthesis.


Blast Summary:  PSI-Blast Search
Numerous hits in gapped BLAST to predicted PTH proteins, e.g. residues 5-186 are 39% similar to SP5C_BACSU. Residues 5-174 are 37% similar to the enzyme in A.aeolicus (AE000685). UU078 is also similar to MG083, CT800 and TP1011, all predicted pth proteins.


COGS Summary:  COGS Search
The phylogenetic pattern of COG0193 is ehgpc-yu.
Cog name: Peptidyl-tRNA hydrolase.
Functional class: J.
BeTs to -hg-c-yu.
Number of proteins in this genome belonging to this COG is 1



Blocks Summary:  Blocks Search
Residues 5-29, 60-71, 88-126, and 128-136 are similar to blocks BL01195A-D, which encompass peptidyl-tRNA hydrolase sequences.




ProDom Summary:  Protein Domain Search
Residues 5-186 are 45% similar to a peptidyl-tRNA hydrolase (sporulation) domain as observed in SP5C_BACSU.

Paralogs:  Local Blast Search
No paralogs in U.u.

Pfam Summary:  Pfam Search
Residues 5 to 186 (E-value = 5.3e-64) place UU078 in the Pept_tRNA_hydro family which is described as Peptidyl-tRNA hydrolase (PF01195)

Structural Feature(s):
Feature Type  Start  Stop
non-globular  
71  
186

PDB Hit:
gi|3114515|pdb|2PTH| Peptidyl-Trna Hydrolase From Escherichia Coli

Gene Protein Sequence:
VEKYLIVGLGNPGSNYAKTRHNVGFMVINEICNKLNLSLDSSKFNGIFTK
TIYNNSIVFFCQPTTYMNLSGEFVIKMLNFYNIPIKNLIVIYDDVDTKLG
TIKLRKKGSSGGQNGIKNIINILKTDEIKRIRIGIDKDPHIKLDQYVLSN
FKIDELVIIKPAIIKGALATLAAIGEDFDKVMNKFN$

Gene Nucleotide Sequence:  Sequence Viewer
GTGGAAAAATATTTAATTGTTGGATTAGGTAATCCAGGATCAAACTATGC
AAAAACAAGACATAATGTTGGCTTTATGGTTATTAATGAGATTTGCAACA
AACTTAATTTGTCTCTAGATAGTTCAAAATTTAATGGAATTTTTACTAAA
ACAATTTATAACAATTCCATAGTGTTTTTTTGTCAACCAACAACTTACAT
GAATTTAAGTGGTGAATTTGTTATCAAAATGCTTAATTTTTATAATATTC
CAATTAAAAATTTAATAGTTATTTATGATGATGTTGATACGAAATTAGGA
ACGATAAAATTGAGAAAAAAGGGGTCCTCAGGAGGGCAAAATGGAATTAA
AAATATTATTAACATTTTAAAAACAGATGAAATTAAACGCATTCGTATAG
GAATTGATAAAGATCCACATATAAAATTAGATCAATATGTCTTATCGAAT
TTTAAGATTGACGAATTAGTTATAATTAAACCAGCTATTATAAAGGGCGC
TTTAGCTACATTAGCAGCGATTGGTGAAGATTTTGATAAAGTTATGAACA
AATTTAATTAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy