Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Ureaplasma urealyticum Search Results

Record: 1 of 1  
MiniMap IGR67 IGR64 IGR61 IGR62 IGR66 IGR65 IGR60 ptsK,hprK, - UU076 UU073 UU077 lgt, - UU075 UU071 UU080 dnaN, - UU079 tlyC, - UU072 parE,gyrB, - UU081 ptsK,hprK, - UU076 UU073 UU077 lgt, - UU075 UU071 UU080 dnaN, - UU079 tlyC, - UU072 parE,gyrB, - UU081 Type: tandem, Name:  - 53 Type: tandem, Name:  - 50 Type: tandem, Name:  - 395 Type: tandem, Name:  - 51 Type: tandem, Name:  - 52 Type: tandem, Name:  - 54 Type: tandem, Name:  - 438 ptsK,hprK, - UU076 UU073 UU077 lgt, - UU075 UU071 pth, - UU078 trxB, - UU074 pth, - UU078 trxB, - UU074 UU080 dnaN, - UU079 tlyC, - UU072 parE,gyrB, - UU081
* Calculated from Protein Sequence

Gene ID: UU076

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
ptsK  hprK  

Definition:
probable HPRK (Ser) kinase

Gene Start:
93827

Gene Stop:
92901

Gene Length:
927

Molecular Weight*:
35000

pI*:
9.90

Net Charge*:
6.71

EC:
2.7.1.-  

Functional Class:
regulatory functions  
transport and binding proteins; carbohydrates, organic alcohols, and acids  

Pathway: pathway table

Comment:
HPr kinase regulates carbohydrate uptake and metabolism by phosphorylating a serine of phosphoryl carrier protein (HPr) of the phosphenolpyruvate-dependent sugar phosphotransferase system(PTS).

See UU587, a predicted ptsH sequence.

Blast Summary:  PSI-Blast Search
Five matches in gapped BLAST to predicted HPR (ser) kinase sequences, e.g. residues 7-302 are 39% similar to HPRK_MYCGE (MG085). Residues 6-299 are 29% similar to HPRK_BACSU. UU076 is also similar to TP0591, a predicted ptsK protein. No similarity to C.trachomatis.


COGS Summary:  COGS Search
No COG found in manual search. The following found automatically:

The phylogenetic pattern of COG0464O is EH--CMYU.
Cog name: AAA superfamily and related ATPases.
Functional class: O.
BeTs to ------y-.
Number of proteins in this genome belonging to this COG is 1



Blocks Summary:  Blocks Search
Residues 157-173 are similar to a domain represented by block PR00772B, concerned with heat-labile enterotoxin.


ProDom Summary:  Protein Domain Search
Residues 7-302 are 40% similar to a HPR Ser transferase domain of HPRK_MYCGE.

Paralogs:  Local Blast Search
No paralogs in U.u.

Pfam Summary:  Pfam Search
Residues 5 to 307 (E-value = 2.6e-74) place UU076 in the Hpr_kinase family which is described as HPr Serine kinase (PF02603)

Structural Feature(s):
Feature Type  Start  Stop
non-globular  
109  
308

PDB Hit:


Gene Protein Sequence:
MEIRGKLFVSQVVRKFNLNVVANSDYIDREISTTGITRVGFELAGEILFK
EIWNIVYFGSKESNYFNKFSETIISKKLGKILDLNPPLIIFGKNFKHAGI
LLKLAERYKIPIVEVKYSFYELNFTINSYISQKLSHQSLVHGTLLSVFGI
GVILMGESGVGKSELAIELVKKGHIFVGDDAILVNRIGGNLYGRAEDSTK
DFIEIRGLGIMNFSRSFGIERMIESTKIEIVIELIKPAKHEKIKFERFGR
EIQHKEFLETKIAHYYIPVIEGRSISDIIETAITDYKLKTSGYNSAEEFI
LQINKKGI$

Gene Nucleotide Sequence:  Sequence Viewer
ATGGAAATTCGTGGTAAATTATTTGTTAGTCAAGTTGTTAGAAAGTTTAA
TTTAAACGTTGTTGCAAATTCTGACTATATTGATCGTGAGATTTCTACAA
CAGGAATTACACGTGTTGGATTTGAATTAGCTGGCGAAATTTTGTTTAAA
GAGATTTGAAATATTGTTTATTTTGGTTCAAAAGAAAGCAATTATTTTAA
TAAATTTTCAGAAACGATCATTTCTAAAAAATTAGGAAAAATTTTAGATT
TAAATCCACCATTAATTATTTTTGGTAAAAATTTTAAACATGCTGGAATT
TTGTTAAAATTAGCAGAGCGCTATAAAATTCCAATTGTAGAGGTTAAATA
TAGTTTTTATGAATTAAATTTTACAATTAATAGTTACATTAGTCAAAAAC
TTTCACACCAATCATTAGTTCACGGAACATTATTATCTGTTTTTGGAATC
GGCGTTATTTTAATGGGGGAATCAGGTGTTGGTAAATCTGAGTTAGCAAT
TGAATTAGTTAAAAAAGGTCATATTTTTGTAGGTGATGATGCTATTTTAG
TTAATAGAATTGGAGGTAATCTATATGGAAGAGCTGAAGATTCGACTAAA
GATTTTATTGAAATTAGAGGTTTAGGTATTATGAATTTTTCACGTTCTTT
CGGTATTGAACGAATGATTGAATCAACAAAAATTGAAATAGTTATTGAAT
TAATAAAACCAGCTAAACATGAAAAAATCAAGTTTGAACGTTTTGGTCGT
GAAATTCAACACAAAGAATTTTTAGAAACAAAAATAGCCCATTATTATAT
TCCGGTTATCGAAGGAAGAAGTATTTCAGATATCATTGAGACAGCCATTA
CTGATTATAAATTAAAAACATCAGGTTATAATTCAGCTGAAGAATTTATT
TTACAAATTAATAAAAAGGGGATTTAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy