Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Ureaplasma urealyticum Search Results

Record: 1 of 1  
MiniMap IGR67 IGR64 IGR61 IGR62 IGR66 IGR65 IGR60 ptsK,hprK, - UU076 UU073 UU077 lgt, - UU075 UU071 UU080 dnaN, - UU079 tlyC, - UU072 parE,gyrB, - UU081 ptsK,hprK, - UU076 UU073 UU077 lgt, - UU075 UU071 UU080 dnaN, - UU079 tlyC, - UU072 parE,gyrB, - UU081 Type: tandem, Name:  - 51 Type: tandem, Name:  - 438 Type: tandem, Name:  - 50 Type: tandem, Name:  - 394 Type: tandem, Name:  - 48 Type: tandem, Name:  - 395 Type: tandem, Name:  - 53 Type: tandem, Name:  - 49 Type: tandem, Name:  - 52 ptsK,hprK, - UU076 UU073 UU077 lgt, - UU075 UU071 pth, - UU078 trxB, - UU074 pth, - UU078 trxB, - UU074 dnaN, - UU079 tlyC, - UU072 parE,gyrB, - UU081 UU080
* Calculated from Protein Sequence

Gene ID: UU075

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
lgt  

Definition:
prolipoprotein diacyglyceryl transferase

Gene Start:
92900

Gene Stop:
91893

Gene Length:
1008

Molecular Weight*:
38533

pI*:
9.60

Net Charge*:
6.35

EC:
2.4.99.-  

Functional Class:
fatty acid and phospholipid metabolism; biosynthesis  

Pathway: pathway table
Sphingoglycolipid metabolism

Comment:


Blast Summary:  PSI-Blast Search
A handful of hits in gapped BLAST to prolipoprotein diacylglyceryl transferase sequences, e.g. residues 22-312 are 33% similar to LGT_MYCPN. Residues 21-289 are 26% similar to LGT_BACSU. UU075 is significantly similar to MG086 and TP0852, both predicted prolipoprotein diacylglyceryl transferases. It is weakly similar to CT252, also a predicted prolipoprotein diacylglyceryl transferase (E value 0.048).

COGS Summary:  COGS Search
The phylogenetic pattern of COG0682 is ehgpc--u.
Cog name: Prolipoprotein diacylglyceryl transferase.
Functional class: M.
BeTs to -hg-c--u.
Number of proteins in this genome belonging to this COG is 1



Blocks Summary:  Blocks Search
Residues 27-52, 149-174, 210-222, 242-266 are similar to blocks BL01311A-D, which encompass proliprotein diacylglyceryl transferase proteins.

ProDom Summary:  Protein Domain Search
Residues 22-270 are 38% similar to an LGT domain of LGT_MYCGE.
Residues 22-117 and 140-269 are 41% and 46% similar to LGT domains of LGT_MYCPN. Residues are also similar to LGT domains of STAAU, BACSU, SYNY3.


Paralogs:  Local Blast Search
No paralogs in U.u.

Pfam Summary:  Pfam Search
Residues 18 to 296 (E-value = 1.4e-75) place UU075 in the LGT family which is described as Prolipoprotein diacylglyceryl transferase (PF01790)

Structural Feature(s):
Feature Type  Start  Stop
transmembrane  
23  
52
transmembrane  
63  
86
transmembrane  
100  
123
transmembrane  
143  
161
transmembrane  
211  
230
transmembrane  
234  
253
transmembrane  
271  
298

PDB Hit:


Gene Protein Sequence:
MQLEIINPESTLVNDVVAHRVAFSIGSNFNIYWYGIIFVCGFLIAILTYS
LRLKFHYKVPYDPGFYYIFLAIPMTIIGARLWSLAIGDAKDFFDFRSGGL
AIQGGVIAGVLSAAVYFPLILRMPKYHIRDIDADGNVVIRQPSMWIYADA
IIPTILIGQALGRWGNFINGEIFGAESTVNDLQWLKKAMPAVFEGMKHYF
IEGNKTLFTIYQPLFLYESFFNVIVFVFIYFGLSYIKQLKIGFISMSYFF
FYGVTRFSTESARAPQFSFEGTYIINSLLLIFGVLGALYVQFIAPLLRKK
FLLDAIIEMFYKKKDQIHKFGELRKPEEFLFYCHK$

Gene Nucleotide Sequence:  Sequence Viewer
ATGCAATTAGAAATTATTAATCCAGAAAGCACATTAGTTAATGATGTTGT
TGCACATCGAGTAGCTTTTAGTATTGGTAGCAATTTTAATATATATTGAT
ATGGAATCATCTTTGTATGCGGTTTTTTAATTGCTATACTAACATATAGT
CTACGTTTAAAATTTCATTATAAAGTGCCTTATGATCCAGGATTTTATTA
TATTTTTTTAGCAATTCCCATGACAATTATTGGTGCTCGTTTATGATCAT
TAGCAATCGGTGATGCTAAAGATTTTTTTGATTTTAGAAGTGGAGGGTTA
GCGATTCAAGGCGGGGTGATTGCTGGGGTATTAAGTGCTGCAGTTTATTT
TCCTCTTATTTTGCGCATGCCTAAATATCACATTCGAGATATTGATGCTG
ATGGCAATGTTGTTATTCGCCAACCTAGTATGTGAATATATGCGGATGCT
ATTATTCCAACAATTTTAATTGGTCAGGCATTAGGGCGTTGAGGAAATTT
TATTAACGGTGAAATATTTGGTGCTGAAAGTACTGTTAACGATTTACAAT
GATTAAAAAAAGCTATGCCAGCTGTTTTCGAAGGAATGAAACATTATTTC
ATTGAGGGCAATAAAACTCTATTTACAATTTATCAACCTTTATTTCTATA
TGAATCATTCTTTAATGTAATTGTTTTTGTTTTTATTTATTTTGGCTTGT
CTTACATTAAACAATTAAAAATAGGCTTTATTTCAATGTCATATTTTTTC
TTTTATGGTGTTACTCGTTTTAGTACGGAGTCAGCTCGTGCTCCACAGTT
TAGTTTTGAAGGAACTTATATAATTAATTCATTGTTATTAATCTTTGGTG
TATTAGGTGCATTATATGTACAATTTATAGCGCCACTTTTAAGAAAAAAA
TTCTTATTAGATGCAATTATTGAAATGTTTTATAAAAAGAAAGACCAAAT
TCATAAATTTGGAGAATTAAGAAAGCCAGAAGAATTTTTATTTTATTGTC
ATAAATAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy