Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Ureaplasma urealyticum Search Results

Record: 1 of 1  
MiniMap IGR64 IGR61 IGR62 IGR59 IGR65 IGR60 ptsK,hprK, - UU076 UU073 UU077 lgt, - UU075 hmuU,fecCD, - UU070 UU071 dnaN, - UU079 tlyC, - UU072 ptsK,hprK, - UU076 UU073 UU077 lgt, - UU075 hmuU,fecCD, - UU070 UU071 dnaN, - UU079 tlyC, - UU072 Type: tandem, Name:  - 50 Type: tandem, Name:  - 438 Type: tandem, Name:  - 49 Type: tandem, Name:  - 394 Type: tandem, Name:  - 47 Type: tandem, Name:  - 395 Type: tandem, Name:  - 52 Type: tandem, Name:  - 48 Type: tandem, Name:  - 51 ptsK,hprK, - UU076 UU073 UU077 lgt, - UU075 hmuU,fecCD, - UU070 UU071 pth, - UU078 trxB, - UU074 pth, - UU078 trxB, - UU074 dnaN, - UU079 tlyC, - UU072
* Calculated from Protein Sequence

Gene ID: UU074

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
trxB  

Definition:
thioredoxin reductase

Gene Start:
91874

Gene Stop:
90945

Gene Length:
930

Molecular Weight*:
34136

pI*:
6.50

Net Charge*:
-0.70

EC:
1.6.4.5  

Functional Class:
purines, pyrimidines, nucleosides, and nucleotides; deoxyribonucleotide metabolism  

Pathway: pathway table
Pyrimidine metabolism

Comment:


Blast Summary:  PSI-Blast Search
Numerous hits in gapped BLAST to thioredoxin reductase sequences, e.g. residues 2-305 are 35% similar to TRXB_MYCPN and 33% similar to TRXB_BACSU. UU074 is similar to MG102, TP0814 and CT099, all predicted to be trxB thioredoxin reductase proteins.


COGS Summary:  COGS Search
The phylogenetic pattern of COG0492 is EhgpcmYU.
Cog name: Thioredoxin reductase.
Functional class: O.
BeTs to c-g-cmyu.
Number of proteins in this genome belonging to this COG is 1



Blocks Summary:  Blocks Search
Residues 10-304 span seven regions of similarity to blocks BL00573 A-E, which encompass pyridine nucleotide disulphide oxidoreductases class-II proteins. Residues 6-174 span several regions of similarity to blocks for aromatic-ring hydrolases, pyridine nucleotide-disulfide oxidoreductases class-I, bacterial-type phytoene dehydrogenases, adrenodoxin reductase family signatures, FMO signatures, fumarate reductase/succinate dehydrogenase FAD-binding site proteins, flavin-containing amine oxidase signatures.


ProDom Summary:  Protein Domain Search
Residues 6-52 and 101-213 are 63% and 47% similar to oxidoreductase domains of TRXB_MYCGE.

Paralogs:  Local Blast Search
No paralogs in U.u.

Pfam Summary:  Pfam Search
Residues 7 to 288 (E-value = 1.4e-50) place UU074 in the Pyr_redox family which is described as Pyridine nucleotide-disulphide oxidoreductase (PF00070)

Structural Feature(s):
Feature Type  Start  Stop
non-globular  
43  
132

PDB Hit:
gi|809432|pdb|1TDE| Thioredoxin Reductase (E.C.1.6.4.5) (Wild Type)

Gene Protein Sequence:
MNQEVYDLVIIGAGPAGLAAAVYAKRSGLNVIIVEKQFPGGKIALTSNVE
NYLGINSIPGPELAYKMYEQVLNLNVSIIYEAADEISLKEKYKKIKLTTQ
TLITKTVIIATGTENRRLNILGELEFENKGISYCAICDGPLYKNKAVSVI
GSGNSAVEEAIYLATIAKEVHLIANKPQFKAEQQLVQIANNTPNIKIYYN
KQTFEFFGHQFLEGLKFRDLITNEVTTLNIEANFTFIGLLPSRINTNNLC
IFNEVNGFITTDKNMQTSVCGIFAAGDIVDKNVRQIATATNDGVIAALYA
KEYITRNNW$

Gene Nucleotide Sequence:  Sequence Viewer
ATGAATCAAGAAGTTTACGATTTAGTAATCATTGGCGCAGGTCCAGCCGG
TTTAGCTGCTGCTGTTTATGCTAAACGTTCTGGATTAAATGTGATCATTG
TTGAAAAACAATTCCCAGGAGGAAAAATAGCATTAACATCAAATGTAGAA
AATTATTTAGGTATCAATAGTATTCCAGGACCTGAATTGGCTTATAAAAT
GTACGAACAAGTCTTAAATTTAAATGTTTCTATTATTTATGAAGCTGCTG
ATGAAATATCTTTAAAAGAAAAATATAAAAAAATTAAATTAACTACACAA
ACATTAATTACTAAAACTGTAATTATTGCAACAGGAACAGAAAATAGACG
GTTAAACATTTTAGGTGAATTAGAATTTGAAAACAAGGGAATTAGTTATT
GCGCTATTTGTGATGGACCACTTTATAAAAATAAAGCTGTCTCTGTGATT
GGATCTGGTAACTCTGCTGTGGAAGAGGCCATATATTTAGCTACAATTGC
TAAAGAAGTTCATTTAATTGCCAATAAACCACAATTTAAAGCAGAACAAC
AATTAGTACAAATTGCAAATAACACACCTAATATAAAAATTTATTACAAT
AAACAAACATTCGAATTTTTTGGTCATCAGTTTTTAGAAGGTTTAAAATT
TAGAGATTTAATCACAAACGAAGTAACTACACTAAATATTGAAGCTAATT
TCACTTTTATTGGCCTATTGCCTTCAAGAATTAATACAAATAATTTATGT
ATTTTTAATGAGGTAAACGGATTTATTACAACTGATAAAAATATGCAAAC
TAGTGTTTGTGGTATTTTTGCAGCCGGTGATATTGTTGATAAAAATGTTC
GACAAATTGCGACTGCTACAAATGATGGAGTCATTGCAGCACTTTATGCC
AAAGAGTACATTACAAGAAATAATTGATAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy