Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Ureaplasma urealyticum Search Results

Record: 1 of 1  
MiniMap IGR58 IGR59 IGR53 IGR56 IGR55 IGR54 IGR57 IGR52 IGR51 UU064 UU063 UU067 UU068 fecE, - UU069 hmuU,fecCD, - UU070 pepF, - UU065 UU071 pta, - UU066 lysS, - UU062 UU064 UU063 UU067 UU068 fecE, - UU069 hmuU,fecCD, - UU070 pepF, - UU065 UU071 pta, - UU066 lysS, - UU062 Type: tandem, Name:  - 41 Type: tandem, Name:  - 46 Type: tandem, Name:  - 40 Type: tandem, Name:  - 44 Type: tandem, Name:  - 38 Type: tandem, Name:  - 378 Type: tandem, Name:  - 45 Type: tandem, Name:  - 43 Type: tandem, Name:  - 39 Type: tandem, Name:  - 47 Type: tandem, Name:  - 42 UU064 UU063 UU067 UU068 fecE, - UU069 hmuU,fecCD, - UU070 pepF, - UU065 UU071 pta, - UU066 lysS, - UU062
* Calculated from Protein Sequence

Gene ID: UU066

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
pta  

Definition:
phosphotransacetylase

Gene Start:
82145

Gene Stop:
83026

Gene Length:
882

Molecular Weight*:
33356

pI*:
9.40

Net Charge*:
8.67

EC:
2.3.1.8  

Functional Class:
energy metabolism; pyruvate metabolism  

Pathway: pathway table
Pyruvate metabolism

Comment:
This enzyme catalyzes the formation of acetyl phosphate and CoA from acetyl-CoA and orthophosphate. The PTA function is typically observed in C-terminal residues of bacterial PTA enzymes (e.g. PTA_ECOLI). In Mycoplasma and in U.u. it appears in the N-terminal region of significantly shorter molecules. The N-terminal residues of PTA_ECOLI are said to resemble cobyric acid synthase.


Blast Summary:  PSI-Blast Search
Numerous weakish hits in gapped BLAST to phosphotransacetylase sequences, e.g. residues 66-277 are 27% similar to PTA_MYCGE (E value 1e-12). Residues 25-283 are 25% similar to residues 424-691 of the Synechocystis enzyme (D90908). Similarities to E.coli and HAEIN enzymes are consistent with the latter picture. UU066 is weakly similar to TP0094, a predicted phosphotransacetylase. No similarity to C.trachomatis.



COGS Summary:  COGS Search
The phylogenetic pattern of COG0280 is EHgpc---.
Cog name: Phosphotransacetylase.
Functional class: C.
BeTs to e-g-c---.
Number of proteins in this genome belonging to this COG is 1



Blocks Summary:  Blocks Search
None.

ProDom Summary:  Protein Domain Search
Residues 55-286 are 25% similar to a PTA domain as observed in PTA_ECOLI, residues 460-707.

Paralogs:  Local Blast Search
No paralogs in U.u.

Pfam Summary:  Pfam Search
Residues 3 to 285 (E-value = 1.5e-08) place UU066 in the PTA_PTB family which is described as Phosphate acetyl/butaryl transferase (PF01515)

Structural Feature(s):
Feature Type  Start  Stop
non-globular  
1  
64

PDB Hit:


Gene Protein Sequence:
MLSSINKLKNKLKNLAKKPIKVLFIEQSLEIDKAKKMLSQDTLINIVDLS
SFKTPEIINECEEIWYELRKLKGESRNDAQIAVNDNLNFAVCLSYLKKID
VLIVGANLSSKTCFSSILKILKNPNGSIAYSTMVMINKRELIFMSDCALN
LNLNKQQMIDAAKYSCTISRNYFDVLNNHVGYISYLSQNDVIYQNKNFDF
IGPIQFDAVVDLKVRNKKVPNIHQYHINHYVFDNISIANTVFKIYQTKLN
YLTVGTYISNILTKVSVISRSASSDEIIATTYLLCVAFLTDLT$

Gene Nucleotide Sequence:  Sequence Viewer
ATGTTGAGTTCTATAAATAAGTTAAAAAATAAATTAAAAAATCTAGCAAA
AAAACCAATAAAAGTTTTATTTATTGAACAAAGTTTAGAAATTGATAAAG
CAAAAAAAATGTTAAGTCAAGATACTTTAATTAATATCGTAGATTTGTCA
TCTTTTAAAACACCAGAAATTATTAATGAATGCGAAGAGATTTGATATGA
ATTACGAAAATTAAAAGGTGAGAGTCGAAATGATGCCCAAATAGCAGTTA
ATGACAATTTAAATTTTGCTGTTTGTTTAAGTTATTTAAAAAAAATCGAT
GTTTTAATTGTGGGTGCTAACTTGTCATCAAAAACTTGTTTTAGTAGTAT
CTTAAAGATTTTGAAAAATCCTAACGGTTCGATCGCATATAGTACAATGG
TTATGATTAATAAACGAGAATTAATTTTTATGAGTGATTGTGCTTTAAAT
TTAAACTTGAATAAACAACAAATGATTGATGCAGCAAAATATTCATGCAC
AATTAGTAGAAATTATTTTGATGTTTTAAACAATCATGTGGGATATATTA
GTTATTTAAGTCAAAATGATGTTATTTATCAAAATAAAAATTTTGATTTT
ATTGGCCCAATTCAATTCGATGCTGTAGTTGATTTAAAAGTTCGTAATAA
AAAAGTACCTAATATCCATCAATACCATATTAATCATTATGTTTTTGATA
ATATAAGTATTGCAAATACTGTTTTTAAAATTTATCAAACAAAACTTAAT
TATTTAACAGTCGGTACATATATTAGTAATATCTTAACAAAAGTTAGTGT
TATTAGTCGTTCAGCAAGTAGTGATGAAATTATTGCAACAACTTATTTAT
TATGCGTGGCTTTTTTAACAGATTTAACTTAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy