Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Ureaplasma urealyticum Search Results

Record: 1 of 1  
MiniMap IGR58 IGR53 IGR56 IGR55 IGR49 IGR54 IGR57 IGR50 IGR52 IGR51 UU064 UU063 UU067 UU068 fecE, - UU069 hmuU,fecCD, - UU070 pepF, - UU065 UU061 pta, - UU066 lysS, - UU062 msbA, - UU060 UU064 UU063 UU067 UU068 fecE, - UU069 hmuU,fecCD, - UU070 pepF, - UU065 UU061 pta, - UU066 lysS, - UU062 msbA, - UU060 Type: tandem, Name:  - 41 Type: tandem, Name:  - 46 Type: tandem, Name:  - 40 Type: tandem, Name:  - 44 Type: tandem, Name:  - 38 Type: tandem, Name:  - 45 Type: tandem, Name:  - 43 Type: tandem, Name:  - 39 Type: tandem, Name:  - 378 Type: tandem, Name:  - 42 UU064 UU063 UU067 UU068 fecE, - UU069 hmuU,fecCD, - UU070 pepF, - UU065 UU061 pta, - UU066 lysS, - UU062 msbA, - UU060
* Calculated from Protein Sequence

Gene ID: UU065

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
pepF  

Definition:
oligoendopeptidase F

Gene Start:
82057

Gene Stop:
80231

Gene Length:
1827

Molecular Weight*:
70821

pI*:
9.60

Net Charge*:
8.98

EC:
3.4.24.-  

Functional Class:
translation; degradation of proteins, peptides, and glycopeptides  

Pathway: pathway table

Comment:
See UU507, a predicted pepA sequence; UU521, a predicted pepF sequence; and UU532, a predicted pepP sequence.

See Prosite PDOC00129.

Blast Summary:  PSI-Blast Search
Numerous hits in gapped BLAST to oligopeptidase sequences, e.g. residues
3-605 are 33% similar to PEPF_MYCPN. UU065 is similar to MG183 and CT112, two predicted oligopeptidases.
No similarity to T.pallidum.


COGS Summary:  COGS Search
No COG found in manual search. The following found automatically:

The phylogenetic pattern of COG0339E is Eh--c-Yu.
Cog name: Zn-dependent oligopeptidase.
Functional class: E.
BeTs to -------u.
Number of proteins in this genome belonging to this COG is 1



Blocks Summary:  Blocks Search
Residues 381-391 are similar to block BL00142 concerned with neutral
zinc metallopeptidases, e.g. PEPF_LACLA. Residues 2-34, 496-527 and 488-535
align with blocks BL00975B,G and H concerned with myristoyl-CoA
transferase enzymes.





ProDom Summary:  Protein Domain Search
Residues 8-575 are 36% similar to an oligopeptidase F hydrolase
domain as observed in PEPF_MYCGE.

Paralogs:  Local Blast Search
UU065 is paralogously related to UU521, also predicted to be a pepF
sequence: residues 1-604 are 43% similar to UU521.

Pfam Summary:  Pfam Search
Residues 193 to 586 (E-value = 6.2e-83) place UU065 in the Peptidase_M3 family which is described as Peptidase family M3 (PF01432)

Structural Feature(s):
Feature Type  Start  Stop
non-globular  
400  
444

PDB Hit:


Gene Protein Sequence:
MENKKYEWDLDDLLNNKSLDDLYAEFEEKKAKYIKAFPTFLDSKQNFAQW
QILEEEFTIVANRFYNYVSNNLNTNVVDPKWNSWSQKLSASFYELETALS
NYNSVVLANEAKIKEYLTDSQLNVYTRKYNEIFRYQPHTLNNEQSKLFST
LIRADEGFSTIFSTYTNNDMKFSDAIDAKGKKHPIKNEAEAFVHLKSKDR
VLRKSAYLSMYRAYYDSRESITKMLYYNYLSLNQQAKAKNFDDYIAKAAF
DDVVDKSLITLIYDQVKLYKDTNEDYKKVRNTYLKKLIKVSKIEPWDNGL
PLISKKIDIPIEEAKQMAIDSLSILGDEYVSNIKRAFDEKWVSWLPQKGK
RGGAYSIGGTKGISKYYILMNYTNSLRDVQTIVHELGHSMHSLYSNRTQK
IYSDYKIFYAEIASISNEVYLNYYLLEKYKNDLEMKLMILDEMISGFFAT
TTRQVIFSNFEWIANELINSGAPFTADVVMKEYQKLELEYTNKPIVEDLN
SIYSLSSITPLRIPHFYVGNFYVYKYAVGQVAAIISGHRVFTKVTGAKQK
VFDFLSSGGSKDPLDTIKLLGVDLTKPQAWQEALEIVKLWIKDYKQTIAL
LNKKRSKK$

Gene Nucleotide Sequence:  Sequence Viewer
ATGGAAAATAAAAAATACGAATGAGATCTTGATGATTTATTAAACAACAA
ATCATTAGATGATTTATATGCTGAATTTGAAGAAAAAAAAGCTAAATACA
TTAAAGCTTTTCCAACTTTTTTAGATTCAAAACAAAATTTTGCTCAATGA
CAAATTTTAGAAGAAGAATTCACAATTGTTGCAAATCGTTTTTATAATTA
TGTATCAAATAATTTAAATACTAATGTTGTTGATCCAAAATGAAATTCTT
GATCACAAAAACTATCAGCTTCTTTTTATGAATTAGAAACAGCATTAAGT
AATTATAATAGTGTAGTTTTAGCAAACGAAGCAAAGATTAAAGAATATTT
GACAGATTCTCAATTAAATGTATATACACGCAAGTATAATGAAATTTTTC
GTTATCAACCACACACATTAAATAATGAACAAAGTAAGTTATTTTCAACA
TTAATACGTGCTGATGAAGGTTTTTCAACAATTTTTTCAACATATACAAA
TAATGATATGAAATTTAGTGATGCTATTGATGCAAAAGGTAAAAAACACC
CAATTAAGAATGAAGCAGAAGCTTTTGTTCATTTAAAATCAAAAGATCGC
GTTTTGCGTAAAAGCGCTTATTTATCAATGTATAGAGCATATTATGATTC
ACGTGAATCAATTACAAAAATGTTGTACTACAACTATTTATCATTAAATC
AACAAGCAAAAGCAAAAAACTTTGATGATTATATTGCTAAAGCAGCATTT
GATGATGTTGTTGACAAATCATTAATTACTTTAATTTATGATCAAGTAAA
ACTTTATAAAGATACAAATGAAGATTATAAAAAAGTACGAAATACATATT
TAAAAAAATTAATTAAAGTTTCAAAGATCGAACCTTGAGATAATGGACTA
CCATTAATTTCTAAAAAAATTGACATTCCAATTGAAGAAGCAAAACAAAT
GGCTATTGATTCATTATCAATTTTAGGTGATGAATATGTAAGTAATATTA
AACGAGCATTCGATGAAAAATGAGTTTCATGATTACCACAAAAAGGGAAA
CGTGGTGGGGCTTATTCAATTGGTGGCACAAAGGGTATTAGTAAATATTA
TATTTTAATGAACTATACTAACTCATTACGTGATGTACAAACTATTGTTC
ATGAATTAGGCCACTCAATGCATTCGTTATATTCTAATCGCACACAAAAA
ATTTATAGTGATTACAAGATTTTCTATGCGGAAATTGCATCAATTTCAAA
TGAAGTTTATTTAAACTACTATTTATTAGAAAAATACAAGAACGATCTTG
AAATGAAATTAATGATTTTAGATGAAATGATTAGTGGGTTCTTCGCAACA
ACAACAAGACAAGTAATTTTTTCAAATTTTGAATGAATTGCTAATGAATT
AATTAATAGTGGGGCACCATTTACGGCAGATGTTGTTATGAAAGAATATC
AAAAACTAGAACTTGAATATACTAACAAACCAATTGTAGAGGATCTAAAT
TCAATTTATTCATTATCAAGCATTACTCCACTTCGTATTCCTCATTTTTA
TGTAGGTAATTTTTATGTATATAAATATGCAGTAGGTCAAGTTGCAGCAA
TTATTTCAGGCCATCGTGTTTTCACTAAAGTAACAGGTGCAAAACAAAAA
GTGTTTGATTTCTTATCAAGTGGTGGTTCAAAAGATCCATTAGATACAAT
TAAATTACTAGGTGTTGATTTAACAAAACCACAAGCATGACAAGAAGCCT
TAGAAATTGTTAAATTATGAATTAAAGATTATAAACAAACAATTGCTTTA
CTAAATAAAAAAAGAAGCAAAAAATAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy