Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Ureaplasma urealyticum Search Results

Record: 1 of 1  
MiniMap IGR53 IGR55 IGR49 IGR54 IGR50 IGR52 IGR51 UU064 UU063 UU067 pepF, - UU065 UU061 pta, - UU066 lysS, - UU062 msbA, - UU060 UU064 UU063 UU067 pepF, - UU065 UU061 pta, - UU066 lysS, - UU062 msbA, - UU060 Type: tandem, Name:  - 40 Type: tandem, Name:  - 378 Type: tandem, Name:  - 39 Type: tandem, Name:  - 43 Type: tandem, Name:  - 37 Type: tandem, Name:  - 44 Type: tandem, Name:  - 42 Type: tandem, Name:  - 38 Type: tandem, Name:  - 41 UU064 UU063 UU067 pepF, - UU065 UU061 pta, - UU066 lysS, - UU062 msbA, - UU060 msbA, - UU059 msbA, - UU059
* Calculated from Protein Sequence

Gene ID: UU062

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
lysS  

Definition:
lysyl-tRNA synthetase

Gene Start:
77527

Gene Stop:
79008

Gene Length:
1482

Molecular Weight*:
57293

pI*:
6.30

Net Charge*:
-5.66

EC:
6.1.1.6  

Functional Class:
translation; aminoacyl-tRNA synthetases  

Pathway: pathway table
Aminoacyl-tRNA biosynthesis
Lysine biosynthesis

Comment:
The complete list of predicted and possible tRNA synthetases is: UU062, UU106, UU117, UU123, UU175, UU192, UU197, UU267, UU278, UU285, UU286, UU287, UU365, UU369, UU371, UU410, UU452, UU457, UU458, UU493, UU534, and UU599.

Blast Summary:  PSI-Blast Search
Numerous hits in gapped BLAST to lysyl-tRNA synthetases, e.g. residues 1-491 are 53% similar to SYK_STAAU. Residues 1-490 are 52% similar to the enzyme from Mycoplasma hominis. UU062 is similar to MG136, TP1040 and CT781, all predicted lysyl-tRNA synthetases.


COGS Summary:  COGS Search
The phylogenetic pattern of COG0017 is EHGPCmYu.
Cog name: Lysyl/asparaginyl/aspartyl-tRNA synthetases.
Functional class: J.
BeTs to e--pcmyu.
Number of proteins in this genome belonging to this COG is 2



Blocks Summary:  Blocks Search
Residues 61-83, 175-199, 228-264, 448-486 are similar to blocks PF00152A-D, which encompass class II tRNA synthetases.



ProDom Summary:  Protein Domain Search
Residues 171-486 are 61% similar to an aspartyl- lysyl-tRNA synthetase domain as observed in SYK_STAAU. Residues 1-165 are 44% similar to a related domain as seen in SYK_MYCPN.

Paralogs:  Local Blast Search
UU062 is paralogously related to UU286, a predicted aspartyl-tRNA synthetase, and to UU365, a predicted asparaginyl-tRNA synthetase: residues 46-323 are 27% similar to UU286.


Pfam Summary:  Pfam Search
Residues 61 to 134 (E-value = 2.1e-14) place UU062 in the tRNA_anti family which is described as OB-fold nucleic acid binding domain (PF01336)
Residues 150 to 490 (E-value = 1.1e-151) place UU062 in the tRNA-synt_2 family which is described as tRNA synthetases class II (D, K and N) (PF00152)

PDB Hit:
gi|1311301|pdb|1LYL|A Chain A, Lysyl-Trna Synthetase (Lysu) (E.C.6.1.1.6) Complexed With Lysine

Gene Protein Sequence:
MERKFSDQELIRRTHLQELKNQNKNPFLITKVDRSMFLKDFAEKYKNFSK
EELHNMDLEKLTLAGRLIGIRQTFGIIQDFSAKLQIYINKKNVAPEVFST
FKSLDIGDIIELEGVAMKTNSDEITLNVTNIRLVAKSLKVLPEKYHGLVD
EEIKARQRYLDLIVNDETKNTFIKRSLIIREMRNWLDNKGFFEVETPVLQ
DILSGAAARPFITHHNTLNKEYYLRIATEIALKKCIIGGFEKVYEIGRIF
RNEGMDSTHNPEFTSVELYIAYVDLWYIMQLTEDLIRHIATKLNLLNPTF
RGFSIDLNKPFKKAHMVDLINEYVGVNFFEVKSDEQAIELAKKHHVKLLD
HQKNFGHIVNAFFETFVEEKLVEPTFVYGHPLQVSPLTKKNQSDPRFVDR
FELFICQKEFANAYSEINDPIDQYERFIAQLEEAKLGNDEASELDMEFIE
ALEYGMPPTGGLGIGVDRLVMLLTSNDSIRNVLLFPHMKDKTK$

Gene Nucleotide Sequence:  Sequence Viewer
ATGGAAAGAAAATTTAGTGATCAAGAATTAATCCGTCGTACACACTTACA
AGAATTAAAAAACCAAAATAAAAATCCTTTTTTAATAACAAAAGTTGATA
GAAGTATGTTTTTAAAAGACTTTGCTGAAAAATATAAAAATTTTAGCAAA
GAAGAATTACATAATATGGATTTAGAGAAATTGACACTTGCTGGTCGTTT
AATCGGAATACGTCAAACCTTTGGGATTATTCAAGATTTTTCAGCAAAGT
TACAAATTTATATTAATAAAAAAAATGTTGCTCCAGAGGTTTTTTCAACT
TTTAAATCATTAGATATTGGTGATATTATTGAATTAGAAGGTGTAGCAAT
GAAAACTAATAGTGATGAAATTACTTTAAATGTTACAAACATTCGATTAG
TTGCTAAAAGTCTAAAAGTTCTCCCTGAAAAGTATCATGGATTGGTTGAT
GAAGAAATTAAAGCACGTCAACGTTATTTAGATTTAATTGTTAACGATGA
GACAAAAAATACTTTTATAAAACGATCTTTAATTATACGTGAAATGCGTA
ATTGGTTAGATAATAAAGGTTTTTTTGAAGTTGAAACGCCTGTTTTGCAA
GATATTTTAAGTGGTGCTGCTGCTCGTCCTTTTATTACACATCATAACAC
TTTAAATAAAGAATATTATTTAAGAATTGCTACTGAAATTGCTTTAAAAA
AGTGTATTATTGGGGGTTTTGAAAAAGTATATGAAATAGGTAGAATTTTT
CGAAATGAGGGAATGGATAGTACTCATAATCCTGAATTTACTTCAGTTGA
ATTATATATTGCATATGTTGATTTATGATATATTATGCAACTAACTGAAG
ATTTAATTCGTCATATTGCTACTAAATTAAACTTATTAAATCCTACATTT
AGAGGTTTTAGTATTGATTTAAATAAACCTTTTAAAAAAGCTCATATGGT
TGATTTAATTAATGAATATGTTGGTGTTAATTTTTTTGAAGTTAAAAGCG
ATGAACAAGCAATTGAATTAGCAAAAAAACACCATGTTAAATTATTAGAT
CATCAAAAAAACTTTGGTCATATCGTTAATGCTTTTTTTGAAACTTTTGT
TGAAGAAAAATTAGTTGAACCAACATTTGTATATGGTCATCCGTTACAAG
TTTCTCCACTTACTAAAAAGAATCAGAGTGATCCTCGTTTTGTAGATCGT
TTTGAATTATTTATTTGTCAAAAAGAATTTGCTAATGCTTATAGTGAAAT
TAATGATCCAATTGATCAATATGAACGTTTTATCGCACAGTTAGAAGAAG
CTAAATTAGGAAATGACGAAGCAAGTGAATTAGATATGGAATTTATTGAG
GCCTTAGAATATGGTATGCCTCCAACAGGTGGTTTGGGAATCGGTGTTGA
TCGTTTAGTAATGCTGTTAACAAGTAATGATAGTATTCGTAATGTTTTAT
TATTTCCTCACATGAAAGATAAAACAAAATAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy