Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Ureaplasma urealyticum Search Results

Record: 1 of 1  
MiniMap IGR46 IGR48 IGR45 UU056 smpB, - UU058 msbA, - UU060 vacB, - UU057 mnu,nucA, - UU055 UU056 smpB, - UU058 msbA, - UU060 vacB, - UU057 mnu,nucA, - UU055 Type: tandem, Name:  - 35 Type: tandem, Name:  - 32 Type: tandem, Name:  - 37 Type: tandem, Name:  - 33 Type: tandem, Name:  - 34 Type: tandem, Name:  - 36 UU056 smpB, - UU058 msbA, - UU060 vacB, - UU057 mnu,nucA, - UU055 msbA, - UU059 msbA, - UU059
* Calculated from Protein Sequence

Gene ID: UU057

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
vacB  

Definition:
VACB exoribonuclease (virulence factor)

Gene Start:
70243

Gene Stop:
72408

Gene Length:
2166

Molecular Weight*:
83167

pI*:
6.40

Net Charge*:
-6.77

EC:
3.1.13.1  

Functional Class:
transcription; RNA degradation  

Pathway: pathway table

Comment:
In E.coli, the VACB protein is related to RNB (EC 3.1.13.1), which is responsible for mRNA degradation.

Blast Summary:  PSI-Blast Search
Numerous hits in gapped BLAST to VACB protein sequences, e.g. residues 77-719 are 34% similar to the protein from B.subtilis (Z99121). UU057 is similar to MG104 and CT397, both predicted vacB ribonuclease II proteins. It is weakly similar to CT098 and TP0805, predicted RNB proteins.


COGS Summary:  COGS Search
The phylogenetic pattern of COG0557 is EHgpC-Yu.
Cog name: Exoribonuclease.
Functional class: K.
BeTs to e--pc-yu.
Number of proteins in this genome belonging to this COG is 1


Blocks Summary:  Blocks Search
Residues 1-28, 249-276, 299-335, 447-456, 563-580 are similar to blocks BL01175A-D, concerned with ribonuclease II family proteins, e.g. VACB_ECOLI. Residues 642-658, 652-671, 702-720 are matched to blocks PR00681D, H, I, which encompass S1 signatures, e.g. RS1_MYCLE.




ProDom Summary:  Protein Domain Search
Residues 77-376 and 391-626 are 34% and 35% similar to vacB domains as seen in VACB_MYCGE. Residues 638-719 are 39% similar and 33% similar respectively to VACB domains of VACB_HAEIN and VACB_MYCGE. Residues 647-717 are 33% similar to an RS1 domain of RS1_HELPY.


Paralogs:  Local Blast Search
No paralogs in U.u.

Pfam Summary:  Pfam Search
Residues 173 to 550 (E-value = 2.4e-71) place UU057 in the RNB family which is described as RNB-like protein (PF00773)
Residues 635 to 719 (E-value = 1.9e-09) place UU057 in the S1 family which is described as S1 RNA binding domain (PF00575)

Structural Feature(s):
Feature Type  Start  Stop
non-globular  
1  
146

PDB Hit:


Gene Protein Sequence:
MSDFTKQTITEVISKEERPIPAAILAKKVLEKIPTLNKTDVYKLIDLLIQ
ENTIKKLENNRLVIGYLDYEFDHEIKQGIITINSKGDGFIKEDNTEIEYY
VNKKYLNGALKKDSVKFVKLKKEPKNNLQDAAVIEIVGHAKDHYVGQFIT
LPNGGYYIFVDDPLFYLNINLKDTTGLVNGHKILFKIISQTTKDAIAELV
HIIGHKNDVGSDVLSIVYDNGIDPTFDPQVVDLASKLEFYVDEHQNKIRR
SIIDREIISIDPVGSKDIDDAVYVKKLNDQRYFLGISIADVSFYVQPNTI
LDADAFKRGTSTYLVDRVIPMLPHNISNNICSLNEGEFRMCITCDMVIDK
DGKICWKDVYPAIMKNYRQMSYDEVNDFYEGKSRFESATLTMKEMLLEAK
ELHHILRNKKIKDGYVDFDIKEPKIILDETGVPIDIKIYERKTAQMMVED
FMIAANEAVTMFAEEHMDKTLKEFNLEMPFIYRVHDKPSIINLQKFEIEA
KKLSFNISHDFENIQPNTISNWLKMNDNHVNLPLISKLLLRSMAKASYEI
INTGHFGLASDNYTHFTSPIRRYPDLIVHRLLWMFIFDSQSYTDKQRVEL
VNKLKLITEESNKNEIIAVKTERDVNAAKFAEYMNLHIGKEFIGVVTTVS
SFGVFVELENTIEGLIRIKNLKDDFYDFIPENMTLVGQKRKKIITVGNKV
RVRVIEANKLTRKIDFELVAQ$

Gene Nucleotide Sequence:  Sequence Viewer
ATGAGTGATTTTACGAAACAAACTATTACCGAAGTAATTTCTAAGGAAGA
GCGCCCAATACCCGCTGCTATTCTTGCTAAAAAAGTGTTAGAAAAAATAC
CCACTTTAAATAAAACTGATGTTTATAAACTAATTGATTTATTAATTCAA
GAAAATACTATTAAAAAATTAGAAAATAATCGATTGGTTATTGGTTATCT
AGATTATGAATTTGATCACGAGATCAAACAAGGAATAATTACTATCAATT
CAAAAGGTGATGGCTTCATTAAAGAAGATAATACTGAAATTGAATATTAC
GTCAACAAAAAATATTTAAATGGGGCTTTAAAAAAAGATTCAGTTAAATT
TGTAAAGTTAAAAAAAGAACCTAAAAACAACCTGCAAGATGCTGCTGTAA
TTGAAATTGTTGGGCATGCTAAAGACCATTATGTTGGTCAATTTATAACT
CTTCCTAATGGTGGTTATTACATTTTTGTTGACGATCCTTTATTTTACTT
AAATATAAATTTAAAAGATACTACCGGTTTAGTTAATGGTCACAAAATTC
TTTTTAAAATTATTTCGCAAACAACAAAAGATGCTATTGCAGAATTAGTT
CATATCATAGGTCATAAAAACGATGTTGGTTCTGATGTTTTATCAATCGT
TTATGATAATGGTATTGATCCAACTTTTGATCCACAAGTTGTTGATTTGG
CTTCAAAATTAGAATTTTATGTTGATGAACATCAAAACAAAATTCGACGT
TCAATAATTGATCGTGAAATTATTTCTATTGATCCTGTTGGTTCTAAAGA
TATTGATGATGCTGTTTATGTTAAAAAATTAAATGATCAACGTTACTTTT
TAGGTATTTCTATTGCTGATGTTAGTTTTTATGTACAACCTAACACCATT
CTTGATGCTGATGCTTTTAAAAGGGGAACATCAACATATTTAGTTGATCG
TGTTATTCCAATGCTTCCGCATAATATTTCTAATAATATTTGTTCATTAA
ACGAAGGTGAGTTTCGCATGTGTATAACATGTGATATGGTAATTGACAAA
GATGGAAAAATATGTTGAAAAGATGTTTATCCTGCTATCATGAAAAATTA
TCGTCAAATGTCATATGATGAAGTTAATGATTTTTATGAAGGAAAATCAC
GTTTTGAATCAGCAACATTAACTATGAAAGAAATGTTATTAGAAGCTAAA
GAATTGCACCATATTTTAAGAAATAAAAAAATTAAAGATGGTTATGTTGA
TTTTGATATTAAAGAACCAAAAATTATTTTAGATGAAACTGGTGTCCCTA
TTGATATTAAAATTTACGAACGTAAAACTGCTCAAATGATGGTTGAAGAT
TTTATGATTGCAGCTAATGAGGCTGTAACTATGTTTGCTGAAGAACACAT
GGATAAAACACTAAAAGAATTTAATTTAGAAATGCCTTTTATCTATCGTG
TTCATGATAAACCATCAATTATTAACTTACAAAAATTTGAAATTGAGGCA
AAAAAATTGAGTTTCAATATCTCACATGATTTTGAGAACATTCAACCTAA
CACTATTTCAAATTGACTAAAAATGAATGATAATCATGTTAACTTACCAT
TAATTAGTAAATTATTATTAAGATCAATGGCTAAAGCTTCTTATGAAATT
ATTAATACGGGACATTTTGGTTTAGCATCTGATAACTATACACACTTTAC
ATCACCAATACGGCGTTATCCAGATTTAATTGTACACCGTTTATTATGAA
TGTTTATTTTTGATTCTCAAAGTTATACAGATAAACAACGAGTAGAATTA
GTAAATAAACTGAAGTTAATTACTGAAGAATCAAATAAAAATGAAATTAT
AGCAGTTAAGACTGAACGTGATGTTAATGCTGCTAAATTTGCTGAATATA
TGAATTTACATATTGGTAAAGAATTTATTGGTGTGGTAACAACAGTTTCT
AGTTTTGGTGTTTTTGTTGAACTCGAAAATACGATTGAAGGTTTAATTAG
AATTAAAAATTTAAAAGATGATTTTTATGATTTTATTCCTGAAAACATGA
CTTTAGTTGGTCAAAAAAGAAAGAAAATTATTACTGTTGGCAATAAAGTT
CGTGTACGTGTTATTGAAGCTAACAAACTTACAAGAAAAATTGATTTTGA
ACTAGTTGCACAATAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy