Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Ureaplasma urealyticum Search Results

Record: 1 of 1  
MiniMap IGR44 IGR46 IGR45 UU056 UU050 atpD, - UU054 atpA, - UU053 vacB, - UU057 UU052 mnu,nucA, - UU055 UU056 UU050 atpD, - UU054 atpA, - UU053 vacB, - UU057 UU052 mnu,nucA, - UU055 Type: tandem, Name:  - 33 Type: tandem, Name:  - 30 Type: tandem, Name:  - 35 Type: tandem, Name:  - 31 Type: tandem, Name:  - 32 Type: tandem, Name:  - 34 Type: tandem, Name:  - 437 atpD, - UU054 atpA, - UU053 vacB, - UU057 UU052 mnu,nucA, - UU055 UU051 UU050 UU056 UU051
* Calculated from Protein Sequence

Gene ID: UU054

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
atpD  

Definition:
ATP synthase beta chain

Gene Start:
64878

Gene Stop:
66242

Gene Length:
1365

Molecular Weight*:
50906

pI*:
7.10

Net Charge*:
0.44

EC:
3.6.1.34  

Functional Class:
energy metabolism; ATP-proton motive force interconversion  

Pathway: pathway table
Oxidative phosphorylation

Comment:
The complete list of predicted ATP synthases in U.u. is: UU053, UU054, UU128, UU129, UU130, UU132, UU133, UU134, UU135, UU136, UU137, and UU138.

Blast Summary:  PSI-Blast Search
Numerous hits in gapped BLAST to ATP synthase beta chain sequences, e.g.
residues 1-450 are 40% similar to ATPB_ENTHR. UU054 is similar to MG399, a predicted atpD sequence, and to TP0402 and CT669.

COGS Summary:  COGS Search
The phylogenetic pattern of COG0055 is EHgpcMYU.
Cog name: ATP synthase beta subunit/transcription termination factor rho.
Functional class: C/K.
BeTs to -h-pcmyu.
Number of proteins in this genome belonging to this COG is 2



Blocks Summary:  Blocks Search
Residues 69-342 span six regions of similarity to blocks BL00152A-F,
concerned with ATP synthase alpha and beta subunits, e.g. ATPB_CHLRE,
VATA_GOSHI, ATPB_PECFR.


ProDom Summary:  Protein Domain Search
Residues 85-429 are 44% similar to the ATPA, ATPB domain observed in
ATPB_LACCA. Residues 2-79 are 32% similar to the ATPB domain seen in
ATPB_RHOCA.

Paralogs:  Local Blast Search
UU054 is paralogously related to UU129, UU132, and UU053, predicted
atpD, atpA and atpA sequences. Residues 1-450 are 38% similar to UU129.

Pfam Summary:  Pfam Search
Residues 168 to 345 (E-value = 7.5e-68) place UU054 in the ATP-synt_ab family which is described as ATP synthase alpha/beta family, nucleotide-binding domain (PF00006)

PDB Hit:
gi|2981977|pdb|1SKY|E Chain E, Crystal Structure Of The Nucleotide Free Alpha3beta3 Sub-Complex Of F1-Atpase From The Thermophilic Bacillus Ps3

Gene Protein Sequence:
MNNGRVIKIWSDIVEIEFKNSLPALNHLLTTHDGNTFLLVKRLVDATHAR
AIVVYASKDLAINDIVINTNKSFMVPVGNDSKNNIYNFWGHPLLETNKTP
KYVEMNSTILNERYVDKSIEIVETGIKAIDFFMPILKGYKLGIFGGAGVG
KTVLMKEIIFNLNRHKQANSNIFIGSGERSREAIELYNELTASNLMPNSV
MFISKMNEAPGARTSIVPIGITAAEYLRDQNKENVLLFIDNIYRFIQAEN
EVSTALGKKPSVGGYQSTLESDVTHIQNRLFRNKNGSITSFQTIFLPMDD
LSDPSAVAVFNHLDGKLVLSRAQAAKNIFPAFDPLASSTNAIDPKIIGER
HYNAIIETKKVLKAYKDLEDVILILGFDELDAESKIIVKKALQLEMFFTQ
NFFMTEHFTKAPGQFVPLKETVESVIRILEGKYLKQSPDVFAYIGSNKDI
SQDH$

Gene Nucleotide Sequence:  Sequence Viewer
ATGAATAACGGCCGAGTTATAAAAATCTGATCAGATATTGTCGAAATTGA
ATTTAAAAACAGCTTACCAGCTTTAAATCACTTATTAACAACTCATGATG
GCAATACTTTCTTATTAGTTAAAAGATTAGTTGATGCTACACATGCGAGA
GCAATTGTTGTTTATGCATCAAAAGATTTAGCAATTAATGATATTGTTAT
TAATACAAACAAAAGTTTTATGGTCCCAGTTGGTAATGATTCAAAAAATA
ATATTTATAATTTTTGGGGACATCCTTTATTAGAAACTAATAAAACACCT
AAATATGTTGAAATGAATTCAACAATTTTAAACGAGCGATATGTTGATAA
AAGTATAGAAATTGTAGAGACAGGAATTAAAGCAATTGATTTTTTTATGC
CAATTCTAAAAGGATATAAATTAGGAATCTTTGGTGGTGCTGGAGTTGGT
AAAACAGTTTTAATGAAAGAAATCATTTTTAACTTAAACAGACATAAACA
AGCAAATTCAAATATTTTTATTGGTTCAGGAGAGCGTTCACGTGAAGCAA
TTGAATTATATAATGAATTGACTGCTTCTAATTTAATGCCTAATTCAGTA
ATGTTTATTTCTAAGATGAATGAAGCTCCTGGTGCACGTACTTCAATTGT
ACCAATTGGAATTACTGCTGCTGAATATTTACGTGATCAAAACAAAGAAA
ATGTTTTATTGTTTATTGATAATATTTATCGTTTTATTCAAGCTGAAAAT
GAAGTTTCTACTGCATTAGGTAAAAAACCGTCTGTTGGAGGTTATCAATC
AACACTAGAAAGTGATGTTACACATATTCAAAATCGATTATTTAGAAATA
AAAATGGATCAATTACCTCATTTCAAACAATTTTTTTGCCAATGGATGAT
TTAAGTGATCCATCAGCTGTCGCTGTATTTAATCATTTAGATGGAAAATT
AGTATTATCGCGAGCACAAGCTGCTAAAAATATTTTTCCAGCATTTGATC
CATTAGCAAGCTCAACAAACGCTATTGATCCTAAAATTATTGGTGAACGT
CATTATAATGCAATTATCGAAACTAAAAAAGTTTTAAAAGCTTATAAAGA
TCTAGAAGATGTTATTTTAATTTTAGGTTTTGATGAACTAGATGCTGAAA
GTAAAATTATTGTTAAAAAAGCTTTACAGCTAGAAATGTTCTTTACACAA
AACTTTTTTATGACTGAACATTTCACAAAAGCTCCTGGTCAGTTTGTTCC
ATTAAAAGAGACTGTTGAAAGTGTAATTCGTATTTTAGAAGGTAAATATT
TAAAACAAAGTCCAGATGTTTTTGCCTATATTGGTTCAAATAAGGATATT
TCTCAAGATCATTAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy