Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Ureaplasma urealyticum Search Results

Record: 1 of 1  
MiniMap IGR43 IGR44 IGR45 UU050 atpD, - UU054 UU048 atpA, - UU053 UU052 mnu,nucA, - UU055 UU050 atpD, - UU054 UU048 atpA, - UU053 UU052 mnu,nucA, - UU055 Type: tandem, Name:  - 30 Type: tandem, Name:  - 35 Type: tandem, Name:  - 29 Type: tandem, Name:  - 33 Type: tandem, Name:  - 27 Type: tandem, Name:  - 34 Type: tandem, Name:  - 32 Type: tandem, Name:  - 28 Type: tandem, Name:  - 437 Type: tandem, Name:  - 31 UU050 atpD, - UU054 atpA, - UU053 UU052 mnu,nucA, - UU055 UU051 UU049 UU051 UU048 UU049
* Calculated from Protein Sequence

Gene ID: UU053

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
atpA  

Definition:
ATP synthase alpha chain

Gene Start:
63343

Gene Stop:
64878

Gene Length:
1536

Molecular Weight*:
57708

pI*:
8.40

Net Charge*:
3.87

EC:
3.6.1.34  

Functional Class:
energy metabolism; ATP-proton motive force interconversion  

Pathway: pathway table
Oxidative phosphorylation

Comment:
The complete list of predicted ATP synthases in U.u. is: UU053, UU054, UU128, UU129, UU130, UU132, UU133, UU134, UU135, UU136, UU137, and UU138.

Blast Summary:  PSI-Blast Search
Numerous hits in gapped BLAST to ATPA sequences, e.g. residues 48-393
are 40% similar to ATPA_BACME.
UU053 is similar to MG401, a predicted atpA sequence, to CT669, a predicted
flagellar-type ATP synthase, to TP0402, an fliI flagellum-specific ATP
synthase and to miscellaneous atpD sequences.

COGS Summary:  COGS Search
The phylogenetic pattern of COG0056 is ehgpc-yu.
Cog name: ATP synthase alpha subunit.
Functional class: C.
BeTs to -h-pc-yu.
Number of proteins in this genome belonging to this COG is 2



Blocks Summary:  Blocks Search
Residues 134-171, 224-235, 242-286, and 291-328 are matched to blocks
BL00152B-E, concerned with ATP synthase alpha and beta subunits, e.g.
ATPA_CYACA, ATPA_PROMO.



ProDom Summary:  Protein Domain Search
Residues 99-393 are 45% similar to an ATPA, ATPB domain as observed in
ATPA_BACME.

Paralogs:  Local Blast Search
UU053 is paralogously related to UU132, UU129, and UU054, which are
predicted atpA, atpD and atpD sequences: residues 12-396 are 38%
similar to UU132, a predicted ATP synthase alpha chain.

Pfam Summary:  Pfam Search
Residues 176 to 350 (E-value = 2.2e-73) place UU053 in the ATP-synt_ab family which is described as ATP synthase alpha/beta family, nucleotide-binding domain (PF00006)

PDB Hit:
gi|2981976|pdb|1SKY|B Chain B, Crystal Structure Of The Nucleotide Free Alpha3beta3 Sub-Complex Of F1-Atpase From The Thermophilic Bacillus Ps3

Gene Protein Sequence:
MQNTKANPRIKSIFNYIVTVSGIYDYQHHQIFVLKNDPTVKLFVISAKED
LAYLLISNEHANINIGDEIIETNREENVVTDLNYFGKIIDINNNFIWPKP
LNNLPSAKIAQTNPAFGLAHNLMTVKTLNEQLNTGIVAIDLLIPIGKGQR
ELIIGDRQTGKTHIALNTIINQSRAGTKCIYVAIGQKRESLTTVYETLKA
HDALKNTIIIDAPLTAYEQYLAPYIGMAHAENLSYQDDVLIVFDDLTKHA
NIIREMALLTNKPVGKEAMPSDVFFSHSSLLERAGSFKNRKTITALPILQ
TVDGDITSLISSNIISITDGQIVTSTDLFAAGKVPAINIDLSVSRTGSSV
QSRMITKVAGEINKIFRQYKRHLKLAMLDYEFNKETSLLLHKGKLIDKMF
LQKGFSLFSYRFIVLSTKLIAWGILKGVKDEQKAFMLLDYAINNYEDAQK
AFNTISTTQNYDDKIMKNYFAFILKQYSDYLNLNWEVELEHSFIPLQNEF
LMNVAKFLGDK$

Gene Nucleotide Sequence:  Sequence Viewer
ATGCAAAACACTAAGGCAAACCCTCGTATTAAATCGATTTTTAACTATAT
TGTAACTGTTAGTGGAATCTATGATTATCAACATCATCAAATATTTGTTT
TAAAAAATGATCCAACAGTAAAATTATTTGTTATTTCAGCAAAAGAAGAT
CTTGCTTATTTATTAATTAGCAATGAACATGCTAATATTAATATCGGCGA
TGAAATCATTGAAACAAATCGTGAAGAAAATGTTGTTACTGATTTAAATT
ATTTCGGGAAGATTATAGATATTAATAATAATTTTATTTGACCAAAACCA
CTTAATAATCTTCCATCAGCAAAAATTGCTCAAACTAATCCTGCATTTGG
TTTAGCTCATAATTTAATGACAGTGAAAACTTTAAATGAGCAATTAAATA
CTGGAATTGTAGCAATTGATTTATTAATTCCGATTGGCAAAGGACAAAGG
GAATTAATTATTGGTGATCGTCAAACTGGAAAAACGCATATTGCTTTAAA
TACTATTATTAATCAAAGCCGTGCTGGCACAAAATGTATTTATGTAGCAA
TTGGTCAAAAACGCGAATCATTAACTACTGTTTATGAAACTTTAAAGGCT
CATGACGCATTAAAAAACACAATTATTATCGATGCTCCTTTAACAGCATA
TGAACAATATTTAGCACCATATATTGGAATGGCTCATGCTGAAAACTTAT
CGTATCAAGATGATGTATTAATTGTATTTGATGATCTAACAAAACACGCT
AATATTATTCGTGAAATGGCTTTATTAACAAATAAACCAGTTGGTAAAGA
AGCAATGCCTTCAGATGTATTCTTCTCACATTCATCATTACTTGAACGTG
CTGGTTCATTCAAAAATCGTAAAACAATTACTGCTTTGCCGATTTTACAA
ACAGTTGATGGGGATATTACTTCATTAATCTCTTCAAATATTATTTCTAT
TACTGATGGTCAAATTGTAACTTCAACTGATTTATTTGCTGCTGGTAAAG
TTCCTGCTATTAATATTGATTTATCAGTTTCAAGAACAGGTTCAAGTGTA
CAATCAAGAATGATTACTAAAGTAGCAGGTGAAATTAATAAAATTTTTAG
ACAATACAAACGTCATTTAAAATTAGCAATGTTAGATTATGAATTTAATA
AAGAAACTAGCCTTTTATTGCATAAAGGTAAATTAATAGATAAAATGTTT
TTACAAAAAGGTTTCTCTTTATTTTCATACCGTTTTATTGTTTTAAGTAC
TAAGCTAATTGCCTGAGGCATTTTAAAAGGTGTTAAAGATGAACAAAAAG
CATTTATGTTGTTAGATTATGCGATTAATAATTATGAAGATGCTCAAAAA
GCATTCAATACTATTTCAACAACTCAAAATTATGATGATAAAATTATGAA
AAACTACTTTGCTTTCATCCTAAAACAATACTCTGATTACTTAAATTTAA
ATTGAGAAGTTGAATTAGAACATAGTTTTATTCCTTTACAAAATGAGTTT
TTAATGAATGTAGCAAAATTTTTAGGAGATAAATAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy