Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Ureaplasma urealyticum Search Results

Record: 1 of 1  
MiniMap IGR14 IGR15 IGR19 IGR20 IGR17 IGR13 dnaH, - UU019 UU017 lipL, - UU021 fatC, - UU022 fatD, - UU023 fecC, - UU025 tdhF, - UU018 UU024 UU016 dnaH, - UU019 UU017 lipL, - UU021 fatC, - UU022 fatD, - UU023 fecC, - UU025 tdhF, - UU018 UU024 UU016 Type: tandem, Name:  - 12 Type: tandem, Name:  - 11 Type: tandem, Name:  - 391 Type: tandem, Name:  - 9 Type: tandem, Name:  - 392 Type: tandem, Name:  - 14 Type: tandem, Name:  - 10 Type: tandem, Name:  - 13 dnaH, - UU019 UU017 lipL, - UU021 fatC, - UU022 fatD, - UU023 fecC, - UU025 tdhF, - UU018 UU024 UU016 tmk, - UU020 tmk, - UU020
* Calculated from Protein Sequence

Gene ID: UU021

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
lipL  

Definition:
esterase/lipase 3 (triacylglycerol lipase)

Gene Start:
22010

Gene Stop:
21141

Gene Length:
870

Molecular Weight*:
34084

pI*:
8.00

Net Charge*:
3.03

EC:
3.1.1.3  

Functional Class:
fatty acid and phospholipid metabolism; degradation  

Pathway: pathway table
Glycerolipid metabolism

Comment:


Blast Summary:  PSI-Blast Search
Hits in gapped BLAST to hypotheticals and to lipase-esterases, eg. residues 6-237 are 26% similar to ESL3_MYCPN. UU021 is also similar to MG344, a probable esterase/lipase 3, MG327, a probable esterase/lipase 2, and to MG310.



COGS Summary:  COGS Search
The phylogenetic pattern of COG0570 is EHGPC-Yu.
Cog name: Predicted acyltransferases and hydrolases with the alpha/beta hydrolase fold.
Functional class: R.
BeTs to -h-pc-y-.
Number of proteins in this genome belonging to this COG is 1



Blocks Summary:  Blocks Search
Residues 90-104 are similar to block BL00120B, concerned with lipases and serine proteins.

ProDom Summary:  Protein Domain Search
Residues 14-129 are 37% similar to a hydrolase domain seen in ESL3_MYCPN.

Paralogs:  Local Blast Search
No paralogs in U.u.

Pfam Summary:  Pfam Search
Residues 50 to 269 (E-value = 6.6e-11) place UU021 in the Abhydrolase_1 family which is described as alpha/beta hydrolase fold (PF00561)

Structural Feature(s):
Feature Type  Start  Stop
transmembrane  
98  
115
non-globular  
117  
161

PDB Hit:


Gene Protein Sequence:
MIMELIKTNTLNFYFEPSKSELKKGSIVFIHGLDASPHYFFLINKDLSDY
DCYFVGLPAHGLTPINNKKDLNIKVFAELFINWINEIDLKEFHLLGHSLG
AGIASLVSFIIPQRIEKLILVCPYHYQYLNPFLNKKLFNAWVLFPNPFLK
FKTDVVLKKLYIDYRNNYKTLIETRWESISREYPRIARDVLFLCLSLLNI
KINHELKMAQRNLIMPTLIMVSRHDQLIDFNLAIKVFKNNNKVNQYIFNN
SGHIPFIEEPKLFTNILLSFLEDRFVEQEENDNNDINEK$

Gene Nucleotide Sequence:  Sequence Viewer
ATGATTATGGAATTAATTAAGACTAACACACTTAATTTTTATTTTGAGCC
ATCTAAAAGCGAACTAAAAAAAGGTTCGATTGTTTTTATACACGGCCTTG
ATGCATCTCCACATTATTTTTTTTTAATTAATAAAGATTTATCTGATTAT
GATTGTTATTTTGTTGGATTACCTGCACATGGTTTAACACCTATTAATAA
CAAAAAAGATTTAAATATTAAAGTTTTTGCTGAGTTATTTATTAATTGAA
TTAATGAAATTGATTTAAAAGAATTTCATTTGTTAGGTCATTCATTAGGA
GCGGGGATTGCTAGTTTGGTTAGTTTTATTATCCCCCAACGCATTGAAAA
ATTAATTCTTGTTTGTCCATATCATTATCAATATTTAAATCCGTTTTTAA
ATAAAAAATTATTTAATGCTTGGGTTTTATTTCCCAATCCATTTTTAAAA
TTTAAAACAGATGTCGTTTTAAAAAAATTATATATTGATTATCGTAATAA
TTATAAAACCTTAATAGAAACTCGTTGGGAGTCAATTTCAAGAGAATATC
CACGAATTGCACGCGATGTCTTATTTTTATGTTTATCGTTATTAAATATT
AAAATCAATCATGAATTAAAAATGGCACAGCGTAATTTAATAATGCCAAC
ATTAATTATGGTTTCAAGACATGATCAATTAATTGATTTTAATTTAGCTA
TTAAAGTGTTTAAAAACAACAATAAAGTAAATCAATATATTTTTAATAAT
TCTGGTCATATTCCTTTTATTGAAGAACCAAAATTATTTACTAATATATT
ACTAAGTTTTTTAGAGGATAGATTTGTAGAACAAGAGGAAAATGATAACA
ATGATATTAACGAAAAATAG


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy