Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Ureaplasma urealyticum Search Results

Record: 1 of 1  
MiniMap IGR14 IGR15 IGR19 IGR20 IGR17 IGR13 dnaH, - UU019 UU017 lipL, - UU021 fatC, - UU022 fatD, - UU023 fecC, - UU025 tdhF, - UU018 UU024 UU016 dnaH, - UU019 UU017 lipL, - UU021 fatC, - UU022 fatD, - UU023 fecC, - UU025 tdhF, - UU018 UU024 UU016 Type: tandem, Name:  - 12 Type: tandem, Name:  - 9 Type: tandem, Name:  - 391 Type: tandem, Name:  - 10 Type: tandem, Name:  - 11 Type: tandem, Name:  - 13 Type: tandem, Name:  - 392 dnaH, - UU019 UU017 lipL, - UU021 fatC, - UU022 fatD, - UU023 fecC, - UU025 tdhF, - UU018 UU024 UU016 tmk, - UU020 tmk, - UU020
* Calculated from Protein Sequence

Gene ID: UU020

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
tmk  

Definition:
thymidylate kinase

Gene Start:
21169

Gene Stop:
20468

Gene Length:
702

Molecular Weight*:
27231

pI*:
9.80

Net Charge*:
6.16

EC:
2.7.4.9  

Functional Class:
purines, pyrimidines, nucleosides, and nucleotides; nucleotide and nucleoside interconversions  

Pathway: pathway table
Pyrimidine metabolism

Comment:


Blast Summary:  PSI-Blast Search
Several hits in gapped BLAST to tmk sequences, e.g. residues 16-223 are 37% similar to KTHY_MYCPN. Residues 19-220 are 35% similar to KTHY_BACSU. Similarities are also seen to MG006, TP0354, CT188, all predicted thymidylate kinases.

COGS Summary:  COGS Search
The phylogenetic pattern of COG0125 is ehgpcmyu.
Cog name: Thymidylate kinase.
Functional class: F.
BeTs to -h-pcmyu.
Number of proteins in this genome belonging to this COG is 1



Blocks Summary:  Blocks Search
None.

ProDom Summary:  Protein Domain Search
Residues 16-216 are 39% similar to a thymidylate kinase domain as observed in KTHY_MYCGE.

Paralogs:  Local Blast Search
No evidence of paralogs in U.u.

Pfam Summary:  Pfam Search
Residues 24 to 219 (E-value = 8.1e-36) place UU020 in the Thymidylate_kin family which is described as Thymidylate kinase (PF02223)

PDB Hit:
gi|4139858|pdb|4TMK| Complex Of E. Coli Thymidylate Kinase With The Bisubstrate Inhibitor Tp5a

Gene Protein Sequence:
MITMILTKNSNEKKPLKKGLFIVFEGIDGAGKTSILKQLLEVLKEPKLVN
KIFLTREPGGKNNNAAEMIREFFLKNLEVFDPLTLAYLYASSRAEHVKKT
INPHLEKDHIVISDRFVHSSYIYQGIVQNQSLDVIYQINQQAIGELEIDY
VFYFDVNVNNALNRMKNRFDNTNAFDSQNKQFYEKLLKQYPSVFKVYNQP
KKIIFIDANKNENEVLCEVKEQLLKIFKEHKYI$

Gene Nucleotide Sequence:  Sequence Viewer
ATGATAACAATGATATTAACGAAAAATAGTAATGAAAAAAAACCGCTTAA
AAAAGGATTATTTATTGTTTTTGAAGGAATTGATGGTGCAGGGAAAACTT
CAATCTTAAAACAACTTTTAGAGGTTTTAAAAGAACCTAAACTAGTTAAT
AAAATTTTTTTAACGCGTGAACCTGGTGGAAAAAACAATAATGCAGCAGA
GATGATACGTGAGTTTTTTTTAAAAAATTTAGAAGTTTTTGATCCGTTAA
CACTAGCTTATTTATATGCAAGCAGTCGTGCTGAACACGTAAAAAAAACA
ATCAATCCTCATTTAGAAAAAGATCATATTGTAATTTCAGATCGTTTTGT
TCATTCTTCATATATTTATCAAGGTATTGTTCAAAATCAAAGTTTAGATG
TTATTTACCAAATTAATCAACAAGCAATTGGTGAATTAGAAATAGATTAT
GTTTTTTATTTTGATGTTAATGTTAATAATGCATTAAATCGAATGAAAAA
TCGTTTTGACAATACAAATGCATTCGATTCACAAAATAAACAATTTTATG
AAAAGTTATTAAAACAATACCCTAGTGTTTTTAAAGTTTATAATCAACCT
AAAAAAATTATTTTTATTGATGCCAATAAAAATGAAAATGAAGTATTATG
TGAGGTTAAAGAACAATTATTAAAAATTTTTAAAGAACATAAATATATAT
AA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy