Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Ureaplasma urealyticum Search Results

Record: 1 of 1  
MiniMap IGR5 IGR3 IGR8 IGR4 IGR6 IGR7 IGR9 IGR10 rbsC-2, - UU013 UU012 rbsC-1, - UU014 rpL7/L12, - UU011 rpiB, - UU006 UU008 rpL10, - UU010 UU007 hemK, - UU004 prfA, - UU003 mgtE, - UU009 rbsC-2, - UU013 UU012 rbsC-1, - UU014 rpL7/L12, - UU011 rpiB, - UU006 UU008 rpL10, - UU010 UU007 hemK, - UU004 prfA, - UU003 mgtE, - UU009 Type: tandem, Name:  - 5 Type: tandem, Name:  - 4 Type: tandem, Name:  - 390 Type: tandem, Name:  - 2 Type: tandem, Name:  - 429 Type: tandem, Name:  - 7 Type: tandem, Name:  - 3 Type: tandem, Name:  - 6 UU012 rbsC-1, - UU014 rbsC-2, - UU013 rpiB, - UU006 UU008 rpL10, - UU010 UU007 hemK, - UU004 prfA, - UU003 mgtE, - UU009 hemK, - UU005 hemK, - UU005 rpL7/L12, - UU011
* Calculated from Protein Sequence

Gene ID: UU009

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
mgtE  

Definition:
magnesium cation transport protein

Gene Start:
6175

Gene Stop:
7797

Gene Length:
1623

Molecular Weight*:
60769

pI*:
5.40

Net Charge*:
-6.62

EC:
 

Functional Class:
transport and binding proteins; cations  

Pathway: pathway table

Secondary Evidence:
Aron L, Toth C, Godfrey HP, Cabello FC. 1996. Identification and mapping of a chromosomal gene cluster of Borrelia burgdorferi containing genes expressed in vivo. FEMS Microbiol Lett 145(3):309-14. Medline: 8978084.

Comment:
CBS domains are typically found in copies of two or four (see Pfam entry).

For a review on magnesium transport systems, please refer to Roof and Maguire, 1994 (Medline: 7836620).

Blast Summary:  PSI-Blast Search
Numerous hits in gapped BLAST to Mg2+ transport proteins, e.g. residues 38-482 are 31% similar to the mgtE protein of Borrelia burgdorferi. UU009 is similar to TP0917 and CT194, two predicted mgtE proteins. Residues 16-494 are 30% similar to TP0917. CT194 is known from COGS analysis to have a CBS domain. Curiously no similarity to M. genitalium.


COGS Summary:  COGS Search
The phylogenetic pattern of COG0517 is EHgpCMYu.
Cog name: CBS domain protein.
Functional class: R.
BeTs to ----cmy-.
Number of proteins in this genome belonging to this COG is 2



Blocks Summary:  Blocks Search
None.

ProDom Summary:  Protein Domain Search
Residues 146-263 are 28% similar to an inosine-5'-monophosphate CBS
domain as seen in YC32_METJA (See Pfam summary).

Paralogs:  Local Blast Search
UU009 is very weakly related to UU143, a hypothetical (E value 5e-04).

Pfam Summary:  Pfam Search
Residues 19 to 147 (E-value = 3.3e-27) place UU009 in the MgtE_N family which is described as MgtE intracellular domain (PF03448)
Residues 149 to 207 (E-value = 2.2e-06) place UU009 in the CBS family which is described as CBS domain (PF00571)
Residues 214 to 267 (E-value = 5.4e-12) place UU009 in the CBS family which is described as CBS domain (PF00571)
Residues 339 to 490 (E-value = 1.1e-25) place UU009 in the MgtE family which is described as Divalent cation transporter (PF01769)

Structural Feature(s):
Feature Type  Start  Stop
non-globular  
1  
105
transmembrane  
292  
313
transmembrane  
382  
405
transmembrane  
429  
454
transmembrane  
473  
499

PDB Hit:


Gene Protein Sequence:
VENKQSTLNLNNNTNINQNFLTQNILKTYEHKDITGLKKLLKSKRIDKIV
ESLETINDTQIILFVLVATKDGICGDIFKYLNTELKSKIINDASLQQLRI
ILFELYNDDVIILKNDFPMYTKKILLSLDSQQRAAIKQLSEFDEDEAGSI
INSDFFTINQNLSIKEALIEIKRMYNDFEQSNIIYVVDNYNRLKGYVTIH
SLLFADSFELKISNVIQEDVFYVRSDEDIDAVLDIFRKYQIEQLAVVDKD
NQLIGYISDNDILPVINAETTTDIYKMYGISELDFPYIKSSVFVLFKSRL
LWLAVLMISATCTGFLIDKFQDVGQLVTAGLSTLVIVPIIPAMTGTSGNA
GSQAAASVIRALSVGEITLKEYNKVLAKEFLVGALIGLVLAIINFARLII
YFAIIKPDLQQYNVLYENITNNPHTKMIVGAIVSAGSSVALFFAIVISKL
LGGTLPLLATKLKIDPTIMSTPILSTLLDMVTTIILFGFGIIFLLIIVDK
VKVEQLNNIREHIHAIKNVNSWLPNQNFLLNNLNYSKHFA$

Gene Nucleotide Sequence:  Sequence Viewer
GTGGAAAATAAACAAAGTACATTAAATTTAAATAACAACACAAATATTAA
TCAAAATTTTCTAACACAAAATATTTTAAAAACTTACGAACATAAAGATA
TTACAGGACTTAAAAAATTACTAAAATCAAAACGGATTGATAAAATTGTT
GAAAGTCTTGAAACTATTAATGATACACAAATTATTTTATTTGTATTAGT
TGCCACAAAAGATGGAATTTGTGGTGATATTTTTAAATATTTAAATACTG
AATTAAAATCAAAAATCATAAATGACGCAAGTTTACAGCAATTAAGAATC
ATTTTATTTGAACTTTATAATGATGATGTGATTATTTTAAAAAATGATTT
TCCTATGTATACTAAAAAAATCTTACTTTCATTAGACAGCCAACAAAGAG
CAGCTATTAAGCAATTATCTGAATTTGATGAAGATGAAGCTGGTTCAATC
ATCAATTCTGACTTTTTTACAATCAATCAAAATCTTTCTATCAAAGAAGC
ACTAATTGAAATAAAAAGAATGTATAATGACTTTGAACAAAGTAATATTA
TATATGTAGTAGATAATTATAATCGTTTAAAAGGATATGTAACAATTCAT
TCATTACTTTTTGCAGATTCTTTTGAATTGAAAATTTCTAATGTTATTCA
AGAAGATGTTTTCTATGTTCGTAGTGATGAAGATATTGATGCTGTTTTAG
ATATTTTCAGAAAGTATCAAATTGAACAATTAGCAGTTGTTGATAAAGAT
AACCAATTAATTGGTTATATTAGTGATAATGATATTTTACCCGTAATTAA
TGCTGAAACAACTACTGATATTTATAAAATGTATGGGATTAGCGAATTAG
ATTTTCCTTACATTAAATCAAGTGTTTTTGTTTTATTTAAATCACGTCTA
TTATGATTGGCTGTATTAATGATTTCAGCTACATGTACTGGTTTTTTAAT
TGATAAATTTCAAGATGTAGGACAATTAGTCACAGCAGGTTTATCAACAT
TAGTTATCGTACCAATCATTCCAGCAATGACGGGAACAAGTGGAAATGCT
GGATCACAAGCTGCCGCCTCTGTGATTCGTGCTTTATCAGTTGGTGAAAT
TACTTTAAAAGAATATAATAAAGTCCTTGCCAAAGAATTTTTGGTTGGTG
CTTTAATTGGTTTAGTTTTAGCAATTATTAATTTTGCTCGTTTGATTATA
TATTTTGCTATTATTAAACCTGATTTACAACAATACAATGTTTTATACGA
AAATATTACTAATAATCCACATACTAAAATGATTGTAGGAGCAATTGTTT
CAGCTGGATCATCAGTCGCTTTGTTTTTTGCTATTGTAATTTCTAAATTG
CTTGGTGGAACACTGCCACTTTTAGCAACAAAATTAAAAATTGATCCTAC
AATTATGTCAACACCAATTTTATCGACATTACTTGATATGGTTACAACTA
TTATCCTATTTGGTTTTGGTATTATATTTTTATTAATTATTGTTGATAAA
GTTAAAGTCGAACAACTAAATAATATCCGCGAGCATATTCATGCTATTAA
AAATGTTAATTCATGATTACCTAATCAAAATTTTTTATTAAATAATTTGA
ATTATTCAAAACATTTTGCTTAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy