Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Ureaplasma urealyticum Search Results

Record: 1 of 1  
MiniMap IGR5 IGR3 IGR8 IGR4 IGR2 IGR1 IGR6 IGR7 IGR9 UU012 rpL31, - UU002 rpL7/L12, - UU011 rpiB, - UU006 UU008 rpL10, - UU010 UU007 hemK, - UU004 prfA, - UU003 dnaA, - UU001 mgtE, - UU009 UU012 rpL31, - UU002 rpL7/L12, - UU011 rpiB, - UU006 UU008 rpL10, - UU010 UU007 hemK, - UU004 prfA, - UU003 dnaA, - UU001 mgtE, - UU009 Type: tandem, Name:  - 4 Type: tandem, Name:  - 3 Type: tandem, Name:  - 390 Type: tandem, Name:  - 1 Type: tandem, Name:  - 429 Type: tandem, Name:  - 6 Type: tandem, Name:  - 2 Type: tandem, Name:  - 5 UU012 rpL31, - UU002 rpiB, - UU006 UU008 rpL10, - UU010 UU007 hemK, - UU004 prfA, - UU003 dnaA, - UU001 mgtE, - UU009 hemK, - UU005 hemK, - UU005 rpL7/L12, - UU011
* Calculated from Protein Sequence

Gene ID: UU007

DNA Molecule Name:
1  

Genbank ID:


Gene Name:


Definition:
hypothetical protein

Gene Start:
4991

Gene Stop:
5551

Gene Length:
561

Molecular Weight*:
20187

pI*:
7.90

Net Charge*:
1.09

EC:
 

Functional Class:
hypothetical  

Pathway: pathway table

Comment:
Relatively high G-C content except at 3' end of the cds.

Blast Summary:  PSI-Blast Search
No significant hits in gapped BLAST. No significant similarities to M.genitalium, T.pallidum, or C.trachomatis.

COGS Summary:  COGS Search
None.

Blocks Summary:  Blocks Search
None.

ProDom Summary:  Protein Domain Search
None.

Paralogs:  Local Blast Search
UU007 is weakly similar to UU0042 and UU0041, both uncharacterized
proteins: residues 40-183 are 28% similar to UU0042 and residues 40-176
are 24% similar to UU041. Also, residues 49-171 are 26% similar to UU008,
another hypothetical.

Pfam Summary:  Pfam Search
No significant hits to the Pfam 11.0 database

Structural Feature(s):
Feature Type  Start  Stop
transmembrane  
37  
62
transmembrane  
80  
110
transmembrane  
127  
157

PDB Hit:


Gene Protein Sequence:
MLNILNNVSNSSLYSAASNATAQTGSNLINDLVPETLTASGISIAISVFS
VIGTIVIALSVLPQTIKTLREKDTASLSLLLFLLNGIATAFLTLYGIGLV
TVHPNSFSFLVDIKNGMFIYNREEWVAGYLICGIFLIMGEALCSVTSFIV
LFCKVNNMIKAKKMGMSEEEYYEKQIKPFLKVKGAN$

Gene Nucleotide Sequence:  Sequence Viewer
ATGTTAAATATTTTAAATAATGTATCTAATTCTTCACTATATTCAGCCGC
TTCAAATGCTACTGCGCAAACTGGTTCAAATTTGATCAATGATCTAGTTC
CAGAAACATTAACCGCTTCAGGAATTAGTATCGCTATTTCTGTTTTTAGT
GTTATAGGTACGATCGTTATTGCTTTGAGTGTATTGCCACAAACAATTAA
AACTTTACGTGAAAAAGATACAGCTTCATTAAGTTTATTACTATTCTTGC
TTAATGGTATTGCTACAGCCTTTTTAACTCTATACGGTATTGGACTTGTT
ACAGTTCATCCAAATTCATTTTCATTCTTAGTGGATATTAAAAACGGAAT
GTTCATTTATAATAGAGAAGAGTGAGTTGCTGGATACTTAATCTGCGGTA
TCTTCTTAATTATGGGTGAAGCATTATGTTCAGTAACTTCATTTATTGTT
CTATTCTGCAAAGTTAATAACATGATTAAAGCTAAAAAAATGGGAATGAG
CGAAGAAGAATATTATGAAAAACAAATTAAACCATTCCTAAAAGTGAAAG
GAGCTAACTAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy