Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Ureaplasma urealyticum Search Results

Record: 1 of 1  
MiniMap IGR5 IGR3 IGR514 IGR8 IGR513 IGR4 IGR2 IGR1 IGR6 IGR7 IGR515 IGR9 rpL34,rpmH, - UU604 rnpA, - UU603 UU602 UU012 rpL31, - UU002 rpL7/L12, - UU011 rpiB, - UU006 UU008 rpL10, - UU010 UU007 hemK, - UU004 prfA, - UU003 dnaA, - UU001 mgtE, - UU009 rpL34,rpmH, - UU604 rnpA, - UU603 UU602 UU012 rpL31, - UU002 rpL7/L12, - UU011 rpiB, - UU006 UU008 rpL10, - UU010 UU007 hemK, - UU004 prfA, - UU003 dnaA, - UU001 mgtE, - UU009 Type: tandem, Name:  - 4 Type: tandem, Name:  - 390 Type: tandem, Name:  - 3 Type: tandem, Name:  - 376 Type: tandem, Name:  - 1 Type: tandem, Name:  - 377 Type: tandem, Name:  - 6 Type: tandem, Name:  - 2 Type: tandem, Name:  - 429 Type: tandem, Name:  - 5 UU602 UU012 rnpA, - UU603 rpL34,rpmH, - UU604 rpL31, - UU002 rpiB, - UU006 UU008 rpL10, - UU010 UU007 hemK, - UU004 prfA, - UU003 dnaA, - UU001 mgtE, - UU009 hemK, - UU005 hemK, - UU005 rpL7/L12, - UU011
* Calculated from Protein Sequence

Gene ID: UU005

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
hemK  

Definition:
protoporphyrinogen oxidase partial C-terminal residues

Gene Start:
3861

Gene Stop:
4427

Gene Length:
567

Molecular Weight*:
21542

pI*:
9.90

Net Charge*:
6.14

EC:
1.3.3.4  

Functional Class:
biosynthesis of cofactors, prosthetic groups, and carriers; heme and porphyrin  

Pathway: pathway table
Porphyrin and chlorophyll metabolism

Secondary Evidence:
Dailey TA, Meissner P, Dailey HA. 1994. Expression of a cloned protoporphyrinogen oxidase. J Biol Chem 269(2):813-5. Medline: 8288631.

Labbe P, Camadro JM, Chambon H. 1985. Fluorometric assays for coproporphyrinogen oxidase and protoporphyrinogen oxidase. Anal Biochem 149(1):248-60. Medline: 3907404.

Sasarman A, Chartrand P, Lavoie M, Tardif D, Proschek R, Lapointe C. 1979. Mapping of a new hem gene in Escherichia coli K12. J Gen Microbiol. 113(2):297-303. Medline: 390093.

Comment:
Protoporphyrinogen oxidases have some domain similarities to N-6 Adenine-specific DNA methylases, however we believe the correct/primary EC number has been assigned to UU004 and UU005. These enzymes are typically constituted of 425-455 residues in bacteria; UU004 appears to represent only the first 272-390 of the residues whereas UU005 may represent the C-terminal residues (false internal stop?). UU005 may be itself a member of the SUA5/yciO/yrdC family (see Prosite PDOC00883). Protoporphyrinogen oxidase is the enzyme that catalyzes in the penultimate step in the heme biosynthetic pathway.

See UU274, a predicted hemN sequence.

Blast Summary:  PSI-Blast Search
Several weak hits in gapped BLAST to hypothetical proteins of bacteria, plus stronger hits to mycoplasma C-terminal residues of protoporphyrinogen oxidase, e.g. residues 5-124 are 34% similar to residues 272-390 of MG259. UU005 may be a spurious piece of a naturally occurring coding region or it may be like other bacterial coding sequences, usually denoted hypothetical, that have naturally broken away from the hemK gene (see Pfam notes).


COGS Summary:  COGS Search
The phylogenetic pattern of COG0009 is EH--Cmy-.
Cog name: Putative translation factor.
Functional class: J.
BeTs to e---cm--.
Number of proteins in this genome belonging to this COG is 1



Blocks Summary:  Blocks Search
None.

ProDom Summary:  Protein Domain Search
Residues 5-173 are 32% similar to residues 274-439 of Y259_MYCPN, a probable protoporphyrinogen oxidase.

Paralogs:  Local Blast Search
No evidence of paralogs in U.u.

Pfam Summary:  Pfam Search
Residues 18 to 168 (E-value = 2.6e-08) place UU005 in the Sua5_yciO_yrdC family which is described as yrdC domain (PF01300)

PDB Hit:


Gene Protein Sequence:
VILNMKIYRITNLNVIYDALMANKCVLIPTDTIIGLLAKNQDVIYEIKQR
DRNKKIIRFVADYKLLGDLTVEQKQFLDLFWPGSVTIIKNGISYRMPNSP
YILKLIQKLGPLYCSSANISGEEPIKNHNEAIFKFGANSKLIYVEAQQQI
GVPSTIVDIDKWEYIRRGANVEMVDMFIKELKDNKTGK$

Gene Nucleotide Sequence:  Sequence Viewer
GTAATATTAAATATGAAAATTTATAGAATAACTAATTTAAATGTGATTTA
TGATGCTTTAATGGCCAATAAATGTGTTCTAATCCCTACTGATACTATCA
TTGGTTTATTAGCAAAAAATCAAGATGTAATTTATGAAATTAAGCAACGT
GATCGAAATAAGAAAATCATCCGCTTTGTAGCCGATTACAAATTACTTGG
TGATTTAACTGTAGAACAAAAGCAATTTTTAGATCTTTTTTGACCAGGTT
CTGTCACTATCATTAAAAATGGTATTTCTTATCGTATGCCAAATAGCCCT
TATATACTAAAATTAATTCAAAAGTTAGGTCCGTTATATTGTAGTAGTGC
TAATATTTCAGGTGAAGAACCAATTAAAAATCATAATGAAGCAATTTTTA
AATTTGGAGCAAATAGTAAACTAATTTATGTTGAAGCACAACAACAAATT
GGTGTTCCATCAACTATTGTTGACATCGATAAATGAGAATACATTCGTCG
TGGTGCTAATGTTGAGATGGTAGATATGTTTATTAAAGAACTAAAAGATA
ATAAAACAGGGAAATAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy