Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Ureaplasma urealyticum Search Results

Record: 1 of 1  
MiniMap IGR5 IGR3 IGR514 IGR511 IGR513 IGR512 IGR4 IGR2 IGR1 IGR6 IGR515 rpL34,rpmH, - UU604 rnpA, - UU603 ksgA, - UU601 UU600 UU602 rpL31, - UU002 rpiB, - UU006 UU008 UU007 hemK, - UU004 prfA, - UU003 dnaA, - UU001 mgtE, - UU009 rpL34,rpmH, - UU604 rnpA, - UU603 ksgA, - UU601 UU600 UU602 rpL31, - UU002 rpiB, - UU006 UU008 UU007 hemK, - UU004 prfA, - UU003 dnaA, - UU001 mgtE, - UU009 Type: tandem, Name:  - 4 Type: tandem, Name:  - 375 Type: tandem, Name:  - 390 Type: tandem, Name:  - 3 Type: tandem, Name:  - 373 Type: tandem, Name:  - 429 Type: tandem, Name:  - 1 Type: tandem, Name:  - 377 Type: tandem, Name:  - 374 Type: tandem, Name:  - 6 Type: tandem, Name:  - 2 Type: tandem, Name:  - 376 Type: tandem, Name:  - 5 rnpA, - UU603 ksgA, - UU601 UU600 UU602 rpL34,rpmH, - UU604 rpL31, - UU002 rpiB, - UU006 UU008 UU007 hemK, - UU004 prfA, - UU003 dnaA, - UU001 mgtE, - UU009 hemK, - UU005 hemK, - UU005
* Calculated from Protein Sequence

Gene ID: UU002

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
rpL31  

Definition:
50S ribosomal protein L31

Gene Start:
1515

Gene Stop:
1802

Gene Length:
288

Molecular Weight*:
10720

pI*:
10.00

Net Charge*:
8.23

EC:
 

Functional Class:
translation; ribosomal proteins  

Pathway: pathway table

Secondary Evidence:
Eistetter AJ, Butler PD, Traut RR, Fanning TG. 1999. Characterization of Escherichia coli 50S ribosomal protein L31.
FEMS Microbiol Lett 180(2):345-9. Medline: 10556732.

Lapidus A, Galleron N, Sorokin A, Ehrlich SD. 1997. Sequencing and functional annotation of the Bacillus subtilis genes in the 200 kb rrnB-dnaB region. Microbiology 143 (Pt 11): 3431-41. Medline: 9387221.

Herold M, Nierhaus KH. 1987. Incorporation of six additional proteins to complete the assembly map of the 50 S subunit from Escherichia coli ribosomes. J Biol Chem 262(18):8826-33. Medline: 3298242.

Comment:
UU002 is predicted to be 92 amino acid residues.

Blast Summary:  PSI-Blast Search
Hits in gapped BLAST to many predicted 50S ribosomal proteins, including one from Mycoplasma genitalium (RL31_MYCGE; sp|P47499), where residues 4-69 of UU002 are 50% similar. M. pneumoniae (sp|P78020|RL31_MYCPN) and Helicobacter pylori (sp|P56053|RL31_HELPY) were the second and third best hits.


UU002 is orthologously related to MG257, a predicted 50S ribosomal protein from M. genitalium: residues 4-95 of UU002 are 45% similar to residues 5-97 of MG257. UU002 is also similar to predicted ribosomal proteins from M. pneumoniae (MP0476) and T. pallidum (TP0255). CT022 is a predicted L31 sequence that has no obvious similarity to UU002. There is no similarity to C. trachomatis or C. pneumoniae.

COGS Summary:  COGS Search
The phylogenetic pattern of COG is Ehgpc--u.
Cog name: 50S ribosomal protein L31.
Functional class: J.
BeTs to e-g-c--u.
Number of proteins in this genome belonging to this COG is 1



Blocks Summary:  Blocks Search
Residues 32-66 and 33-67 are similar to block BL0043, constituted of ribosomal L31 proteins, e.g.
RL31_ECOLI.

ProDom Summary:  Protein Domain Search
Residues 4-63 are 49% similar to an L31 domain of RL31_MYCGE.

Paralogs:  Local Blast Search
No paralogs in U.u.

Pfam Summary:  Pfam Search
Residues 1 to 69 (E-value = 5.7e-19) place UU002 in the Ribosomal_L31 family which is described as Ribosomal protein L31 (PF01197)

PDB Hit:


Gene Protein Sequence:
MRDIHPVSKPCVYNCVTCKKEFIIDSAAKNTEVAIEVCSNCHTFFIGKQN
ATTTLRGRAEKLNNRFEAGLNNINKKPEKKKIQGKSEPRKSLNEL$

Gene Nucleotide Sequence:  Sequence Viewer
ATGAGAGATATTCATCCAGTAAGCAAACCATGCGTTTATAATTGTGTAAC
ATGTAAAAAAGAATTTATAATTGATTCTGCAGCAAAAAATACAGAAGTTG
CAATTGAAGTTTGTTCAAATTGCCATACATTTTTTATTGGTAAACAAAAC
GCAACTACAACATTACGTGGTCGTGCTGAAAAACTAAATAATCGTTTTGA
AGCTGGTTTAAATAACATTAATAAAAAACCAGAAAAGAAAAAAATACAAG
GTAAATCTGAACCAAGAAAAAGTTTAAACGAATTATAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy