Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Ureaplasma urealyticum Search Results

Record: 1 of 1  
MiniMap IGR5 IGR3 IGR514 IGR511 IGR513 IGR512 IGR4 IGR2 IGR1 IGR515 rpL34,rpmH, - UU604 rnpA, - UU603 ksgA, - UU601 UU602 gluS,gltX,syE, - UU599 rpL31, - UU002 rpiB, - UU006 UU008 UU007 hemK, - UU004 prfA, - UU003 dnaA, - UU001 rpL34,rpmH, - UU604 rnpA, - UU603 ksgA, - UU601 UU602 gluS,gltX,syE, - UU599 rpL31, - UU002 rpiB, - UU006 UU008 UU007 hemK, - UU004 prfA, - UU003 dnaA, - UU001 Type: tandem, Name:  - 4 Type: tandem, Name:  - 374 Type: tandem, Name:  - 377 Type: tandem, Name:  - 3 Type: tandem, Name:  - 372 Type: tandem, Name:  - 390 Type: tandem, Name:  - 1 Type: tandem, Name:  - 376 Type: tandem, Name:  - 373 Type: tandem, Name:  - 6 Type: tandem, Name:  - 2 Type: tandem, Name:  - 375 Type: tandem, Name:  - 5 rnpA, - UU603 ksgA, - UU601 UU602 gluS,gltX,syE, - UU599 UU600 UU600 rpL34,rpmH, - UU604 rpL31, - UU002 rpiB, - UU006 UU007 hemK, - UU004 prfA, - UU003 dnaA, - UU001 hemK, - UU005 hemK, - UU005 UU008
* Calculated from Protein Sequence

Gene ID: UU001

DNA Molecule Name:
1  

Genbank ID:
0

Gene Name:
dnaA  

Definition:
chromosome replication initiator protein DnaA

Gene Start:
1

Gene Stop:
1374

Gene Length:
1374

Molecular Weight*:
52643

pI*:
7.90

Net Charge*:
3.15

EC:
 

Functional Class:
replication; DNA replication, restriction, modification, recombination, and repair  

Pathway: pathway table

Comment:
UU001, like TP0001, announces the start of the chromosomal coding.

The complete list of dna genes in U.u. are: UU001, a predicted dnaA sequence; UU019, a predicted dnaH sequence; UU079, a predicted dnaN sequence; UU087, a predicted dnaX sequence; UU339, a predicted dnaK sequence; UU407, a predicted dnaJ sequence; UU415, a predicted dnaE sequence; UU494, a predicted dnaG sequence; and UU550, a predicted dnaB sequence.

In E. coli, the N-terminus of the DnaA protein promotes oligomerization (Weigel C, et al., 1999. Medline: 10540285). For a review on initiation of chromosomal replication in E. coli see Herrick J., et al. 1996; Medline: 8820637.

Blast Summary:  PSI-Blast Search
Several hits in gapped BLAST to DnaA proteins, e.g. residues
116-456 are 32% similar to the predicted DnaA protein of Mycoplasma capricolum (DNAA_MYCCA). Within STDGEN, UU001 is most similar to MG469 a predicted chromosome replication initiator protein from Mycoplasma genitalium; the other strong similarity is to MP0156, a predicted DnaA chromosomal replication protein from Mycoplasma pneumoniae. Weaker similarities are to predicted proteins involved in replication including TP0001, CPn0424, CT275, CT250, and CPn0309.


Of the top twenty or so hits in
gapped BLAST against an NR database, none were other than to DNAA sequences.

COGS Summary:  COGS Search
The phylogenetic pattern of COG0593 is EHgpc--u.
Cog name: ATPase involved in DNA replication initiation.
Functional class: L.
BeTs to e-g-c--u.
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search
Residues 114-434 are similar to Blocks B01008A-E,
concerned with DnaA proteins, e.g. DNAA_MYCCA, DNAA_PSEPU.
Lesser similarities involve other blocks concerned with
CTF/NF-I proteins, glycosyl hydrolases, etc.

ProDom Summary:  Protein Domain Search
Residues 116-260 are 37% similar to a well-defined DnaA
domain of DNAA_MYCCA.

Paralogs:  Local Blast Search
No significant paralogs in U.u.


Pfam Summary:  Pfam Search
Residues 113 to 435 (E-value = 2.1e-65) place UU001 in the Bac_DnaA family which is described as Bacterial dnaA protein (PF00308)

Structural Feature(s):
Feature Type  Start  Stop
transmembrane  
41  
64
non-globular  
65  
139

PDB Hit:


Gene Protein Sequence:
MANNYQTLYDSAIKRIPYDLISDQAYAILQNAKTHKVCDGVLYIIVANAF
EKSIINGNFINIISKYLSEEFKKENIVNFEFIIDNEKLLINSNFLIKETN
IKNRFNFSDELLRYNFNNLVISNFNQKAIKAIENLFSNNYDNSSMCNPLF
LFGKVGVGKTHIVAAAGNRFANSNPNLKIYYYEGQDFFRKFCSASLKGTS
YVEEFKKEIASADLLIFEDIQNIQSRDSTAELFFNIFNDIKLNGGKIILT
SDRTPNELNGFHNRIISRLASGLQCKISQPDKNEAIKIINNWFEFKKKYQ
ITDEAKEYIAEGFHTDIRQMIGNLKQICFWADNDTNKDLIITKDYVIECS
VENEIPLNIVVKKQFKPEQIIEIVAKELNIKTDLIKSSIRKNNIVWARDI
VCYILKNKLNLTLTDIGKLLNGREHTTISHSISKVQKILDDENSQEALQI
NLIINKF$

Gene Nucleotide Sequence:  Sequence Viewer
ATGGCTAATAATTATCAAACTTTATATGATTCAGCAATAAAAAGGATTCC
ATACGATCTTATTTCTGATCAAGCTTATGCAATTCTACAAAATGCTAAAA
CTCATAAAGTTTGCGATGGTGTTTTATATATAATTGTAGCCAATGCCTTT
GAAAAAAGTATTATTAACGGTAATTTTATTAACATTATTTCTAAATATCT
AAGCGAAGAATTCAAAAAGGAAAATATTGTTAATTTTGAATTTATTATAG
ACAATGAAAAATTATTAATTAATAGCAATTTTTTAATTAAAGAAACTAAT
ATTAAAAATCGTTTTAATTTTAGTGATGAACTTTTACGTTACAATTTTAA
CAATTTAGTAATTAGTAATTTTAATCAAAAAGCGATTAAGGCGATTGAAA
ATTTATTTTCAAATAACTATGATAATAGTTCAATGTGTAACCCTTTATTT
TTATTTGGTAAAGTTGGTGTTGGTAAAACGCATATCGTGGCTGCTGCTGG
TAATCGTTTTGCTAATAGTAATCCTAATTTAAAAATTTATTATTATGAAG
GGCAAGATTTTTTTCGAAAGTTTTGTTCTGCTTCGTTAAAAGGGACTAGT
TATGTTGAAGAGTTTAAAAAAGAAATTGCTTCAGCAGATTTATTAATTTT
TGAAGATATTCAAAATATCCAATCACGTGATTCAACGGCTGAATTGTTTT
TTAATATCTTTAATGATATAAAATTAAATGGTGGAAAAATTATCTTAACA
TCTGACCGTACACCAAACGAACTTAATGGTTTTCATAATCGAATTATTTC
GAGATTAGCGTCAGGTTTGCAGTGTAAAATTTCTCAACCCGACAAAAATG
AAGCTATTAAAATTATTAATAATTGGTTTGAATTCAAAAAAAAATATCAA
ATTACTGACGAAGCTAAAGAATATATTGCTGAAGGTTTTCACACTGATAT
TAGACAGATGATTGGTAATCTAAAACAAATTTGTTTTTGAGCGGACAATG
ATACTAATAAAGATTTAATAATCACAAAAGATTATGTAATTGAGTGTTCA
GTTGAAAACGAAATTCCACTAAATATTGTTGTTAAAAAACAATTTAAACC
TGAACAAATAATTGAAATTGTTGCAAAAGAATTAAATATAAAAACAGATT
TAATTAAATCTTCTATTAGAAAAAATAATATAGTTTGAGCGCGTGATATT
GTTTGTTATATTCTAAAAAATAAACTAAATTTAACTTTAACAGATATTGG
TAAATTACTAAACGGACGAGAACACACTACAATTAGTCATAGTATTAGTA
AAGTTCAAAAAATTCTTGATGATGAAAATAGTCAAGAAGCACTACAAATT
AATCTAATTATCAATAAATTTTAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy