Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Treponema pallidum Search Results

Record: 1 of 1  
MiniMap IGR771 IGR1 IGR770 IGR772 IGR767 IGR2 IGR768 IGR769 IGR1.1 TpF1, - TP1038 clpP, - TP1041 hlyIII, - TP1037 lysS, - TP1040 apt, - TP1039 recF, - TP0003 dnaA, - TP0001 TP1036 gyrA, - TP0005 TpF1, - TP1038 clpP, - TP1041 hlyIII, - TP1037 lysS, - TP1040 apt, - TP1039 recF, - TP0003 dnaA, - TP0001 TP1036 gyrA, - TP0005 Type: tandem, Name:  - 4 Type: tandem, Name:  - 1 Type: tandem, Name:  - 225 Type: tandem, Name:  - 2 Type: tandem, Name:  - 3 Type: tandem, Name:  - 5 TpF1, - TP1038 clpP, - TP1041 hlyIII, - TP1037 lysS, - TP1040 apt, - TP1039 recF, - TP0003 dnaA, - TP0001 TP1036 TP0004 dnaN, - TP0002 dnaN, - TP0002 gyrA, - TP0005 TP0004
* Calculated from Protein Sequence

Gene ID: TP1041

DNA Molecule Name:
1  

Genbank ID:
3323371

Gene Name:
clpP  

Definition:
ATP-dependent Clp protease proteolytic component

Gene Start:
1137932

Gene Stop:
1137222

Gene Length:
711

Molecular Weight*:
26366

pI*:
8.34

Net Charge*:
3.73

EC:
3.4.21.92  

Functional Class:
Translation; Degradation of proteins, peptides, and glycopeptides  

Pathway: pathway table
Miscellaneous Enzymes

Comment:
In E. coli, this protein cleaves peptides in various proteins in a
process that requires ATP hydrolysis. It has chymotrypsin-like
activity and may be responsible for a fairly general and central
housekeeping function rather than for the degradation of specific
substrates. ClpP may play the role of a master protease which is
attracted to different substrates by different specificity factors
such as ClpA or ClpX. It is induced by heat shock.

There is a 3D structure known for the E. coli protein.

This protein may have an extra N-terminal region.

See TP0549 (clpC), TP0801 (clpA), TP0507 (clpP), TP0508 (clpX),
TP0071 (clpB).

Blast Summary:  PSI-Blast Search
Gapped BLAST revealed several significant hits to ATP-dependent Clp
protease proteolytic component proteins. For example residues 54-231
are 41% similar to CLPP_ECOLI, ATP-dependent Clp protease proteolytic
component of E. coli,(AE000150).

COGS Summary:  COGS Search
BeTs to 11 clades of COG0740
COG name: Protease subunits of ATP-dependent proteases, ClpP family
Functional Class:  O
The phylogenetic pattern of COG0740 is -----qvCebRhuj--OLINx
Number of proteins in this genome belonging to this COG is 2

Blocks Summary:  Blocks Search
Residues 57-89, 112-163, and 184-227 represent significant (100%)
hits to blocks BL00381A,B,C, Endopeptidase Clp serine proteins.

ProDom Summary:  Protein Domain Search
Residues 59-227 are 46% similar to ATP-dependent Clp protease of
CLPP_ECOLI.

Paralogs:  Local Blast Search
This protein is paralogously related to TP0507, ATP-dependent Clp
protease proteolytic component. Residues 59-231 are 36% similar to
TP0507.

Pfam Summary:  Pfam Search
Residues 52 to 231 (E-value = 4e-85) place TP1041 in the CLP_protease family which is described as Clp protease (PF00574)

Structural Feature(s):
Feature Type  Start  Stop
transmembrane  
115  
144

PDB Hit:
none

Gene Protein Sequence:
MLFKRSFYATLSGSCLVWGCCATVYREHAREKWGVGVVMRCDATQEKRAH
SESGESVFFQKFLETRQILLSGEISKDLAEGIVRQLFVLESLSVSKPIYM
YVDSPGGDVDAGYAIFDVIRFVKTPVYTIGMGLVASAGVLVLLAAKKDCR
FGLRNSRYLIHQPLSGMRGVATDIEIHARELEKTRSKLNALIASETGVSL
DKVAQDTNRDYWLDASQALEYGLISNLIEKRADLPKK

Gene Nucleotide Sequence:  Sequence Viewer
TTGTTATTCAAGAGAAGTTTTTATGCTACACTAAGCGGCTCTTGTTTAGT
GTGGGGCTGTTGCGCGACAGTATACCGTGAGCATGCCCGCGAGAAATGGG
GAGTCGGAGTGGTTATGAGGTGTGATGCTACGCAGGAAAAACGTGCGCAC
TCAGAATCAGGGGAGAGTGTTTTTTTCCAGAAGTTTTTGGAAACGCGGCA
AATTCTCCTTTCAGGGGAAATAAGTAAAGACCTCGCAGAGGGAATAGTAC
GGCAACTCTTTGTATTGGAGTCTCTTTCCGTTTCGAAGCCCATCTATATG
TACGTGGATTCTCCTGGGGGGGATGTGGATGCAGGGTACGCTATTTTTGA
CGTTATTCGCTTCGTCAAGACGCCAGTGTACACAATTGGAATGGGGTTGG
TTGCGAGTGCTGGTGTACTCGTTTTGCTCGCGGCAAAAAAGGATTGTAGG
TTTGGATTGCGCAATAGCCGGTACTTGATACACCAACCCCTTTCTGGTAT
GCGTGGCGTTGCGACAGACATAGAAATCCACGCACGGGAGCTTGAGAAAA
CGCGATCGAAACTGAACGCTTTGATCGCAAGTGAAACGGGTGTGAGCTTA
GATAAAGTTGCACAGGATACAAATCGAGACTACTGGCTCGACGCTTCTCA
AGCACTAGAATATGGTCTCATTTCGAACCTGATTGAAAAAAGGGCGGACC
TTCCTAAGAAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy