Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Treponema pallidum Search Results

Record: 1 of 1  
MiniMap IGR771 IGR1 IGR770 IGR772 IGR767 IGR768 IGR769 IGR1.1 TpF1, - TP1038 clpP, - TP1041 hlyIII, - TP1037 lysS, - TP1040 apt, - TP1039 recF, - TP0003 dnaA, - TP0001 TP1036 TpF1, - TP1038 clpP, - TP1041 hlyIII, - TP1037 lysS, - TP1040 apt, - TP1039 recF, - TP0003 dnaA, - TP0001 TP1036 Type: tandem, Name:  - 4 Type: tandem, Name:  - 1 Type: tandem, Name:  - 225 Type: tandem, Name:  - 2 Type: tandem, Name:  - 3 Type: tandem, Name:  - 5 TpF1, - TP1038 clpP, - TP1041 hlyIII, - TP1037 lysS, - TP1040 apt, - TP1039 recF, - TP0003 dnaA, - TP0001 TP1036 dnaN, - TP0002 dnaN, - TP0002
* Calculated from Protein Sequence

Gene ID: TP1040

DNA Molecule Name:
1  

Genbank ID:
3323370

Gene Name:
lysS  

Definition:
lysyl-tRNA synthetase

Gene Start:
1137219

Gene Stop:
1136167

Gene Length:
1053

Molecular Weight*:
39972

pI*:
6.44

Net Charge*:
-4.42

EC:
6.1.1.6  

Functional Class:
Translation; Amino acyl tRNA synthetases  

Pathway: pathway table
Amino acid metabolism; Lysine biosynthesis
Metabolism of macromolecules; Aminoacyl-tRNA biosynthesis

Comment:
Reaction:
ATP + L-LYSINE + TRNA(LYS) = AMP + PYROPHOSPHATE + L-LYSYL-TRNA(LYS).

Blast Summary:  PSI-Blast Search
Gapped BLAST revealed several significant hits to lysyl-tRNA synthetases.
For example residues 5-344 are 29% similar to SYK3_ECOLI, lysyl-tRNA
synthetase homolog of E. coli,(X59988).

COGS Summary:  COGS Search
BeTs to 11 clades of COG1190
COG name: Lysyl-tRNA synthetases
Functional Class:  J
The phylogenetic pattern of COG1190 is ----YQvcEbRHujgp-lin-
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search
None.

ProDom Summary:  Protein Domain Search
Residues 9-243 are 28% similar to lysyl-tRNA synthetase of SYK3_ECOLI.
Residues 273-344 also support this match.

Paralogs:  Local Blast Search
This protein is paralogously related to TP0985 aspartyl-tRNA synthetase.
Residues 4-130 are 23% similar to TP0985.

Pfam Summary:  Pfam Search
Residues 2 to 351 (E-value = 2.7e-11) place TP1040 in the tRNA-synt_2 family which is described as tRNA synthetases class II (D, K and N) (PF00152)

PDB Hit:
gi|1311301|pdb|1LYL|A Escherichia coli

Gene Protein Sequence:
MDTESVLFRAQCLRAVRDFFLEHHYIELDTPALARALVPERCLEVFQTEY
FTSVHAKDTQKLYLVPSPEVFLKPLIAQLQRSAFQISKCYRNGESMGALH
RPEFTMVEYYTVYADYKTSLDVSSKLFRFVVEQVQSHPLADPYSCACFCA
PFEYVTVEEAFLRYAGFSLSHASSVQTLAQEVLRSGIDLGARAGVDYTQW
SWDDLYELLLVHIVEPKLRSIKDRCVVLYDYPIQISCLAQEHTGRSGIQS
TSPNKGDAPHWVVKERWELYVRGVELINCYTEQRDAKHVTRYCREEQTAK
QGSARVVHPVPEGFAHACARMPPCSGAALGFDRLVALLAGRHSLDAFVYD
Q

Gene Nucleotide Sequence:  Sequence Viewer
ATGGATACCGAATCTGTCCTCTTTCGCGCGCAGTGCTTGCGTGCAGTGCG
TGATTTTTTCCTTGAACACCACTACATAGAGCTCGATACGCCTGCACTCG
CCCGTGCGCTCGTTCCAGAACGGTGTCTTGAGGTGTTTCAAACCGAGTAC
TTTACGTCAGTGCATGCTAAAGATACACAGAAGTTATATCTCGTTCCCTC
TCCTGAGGTTTTTCTGAAACCGCTCATCGCGCAACTGCAACGTTCGGCTT
TTCAGATCTCAAAGTGCTATCGCAATGGAGAGTCCATGGGCGCCTTGCAT
AGGCCGGAATTTACTATGGTCGAATACTACACGGTGTACGCTGACTACAA
GACGTCGCTCGATGTAAGCAGCAAACTCTTTCGCTTTGTGGTTGAACAAG
TACAGAGTCATCCGCTCGCGGACCCATATTCGTGTGCTTGTTTTTGTGCT
CCCTTCGAGTACGTGACGGTCGAGGAAGCTTTTCTCCGCTATGCAGGCTT
TTCCCTTTCGCACGCGAGTAGTGTACAGACGCTTGCGCAGGAAGTATTGC
GCTCCGGAATAGACCTGGGAGCACGTGCGGGGGTCGATTATACCCAGTGG
TCATGGGACGATTTGTACGAACTGTTGCTCGTGCATATTGTTGAACCAAA
GTTGAGGTCAATAAAGGATCGTTGCGTCGTGCTGTATGACTATCCTATAC
AGATATCCTGCCTGGCGCAGGAACACACTGGACGCTCAGGGATACAATCT
ACGTCACCTAACAAGGGTGACGCACCTCACTGGGTGGTAAAGGAACGGTG
GGAACTGTACGTCCGCGGTGTGGAACTCATAAACTGTTACACAGAGCAGC
GGGATGCGAAGCATGTTACCCGGTACTGCAGGGAAGAACAAACCGCAAAA
CAGGGATCTGCGCGAGTTGTGCATCCTGTTCCAGAGGGCTTTGCGCACGC
GTGCGCACGCATGCCCCCTTGCTCTGGAGCAGCACTCGGATTTGATCGCC
TGGTTGCGCTGCTAGCCGGTCGGCACTCATTAGATGCGTTTGTGTATGAT
CAG


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy