Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Treponema pallidum Search Results

Record: 1 of 1  
MiniMap IGR771 IGR1 IGR770 IGR772 IGR767 IGR766 IGR768 IGR769 IGR1.1 TpF1, - TP1038 clpP, - TP1041 hlyIII, - TP1037 lysS, - TP1040 valS, - TP1035 apt, - TP1039 recF, - TP0003 dnaA, - TP0001 TP1036 TpF1, - TP1038 clpP, - TP1041 hlyIII, - TP1037 lysS, - TP1040 valS, - TP1035 apt, - TP1039 recF, - TP0003 dnaA, - TP0001 TP1036 Type: tandem, Name:  - 4 Type: tandem, Name:  - 1 Type: tandem, Name:  - 225 Type: tandem, Name:  - 2 Type: tandem, Name:  - 3 Type: tandem, Name:  - 5 Type: tandem, Name:  - 301 TpF1, - TP1038 clpP, - TP1041 hlyIII, - TP1037 lysS, - TP1040 valS, - TP1035 apt, - TP1039 dnaA, - TP0001 TP1036 dnaN, - TP0002 dnaN, - TP0002 recF, - TP0003
* Calculated from Protein Sequence

Gene ID: TP1039

DNA Molecule Name:
1  

Genbank ID:
3323369

Gene Name:
apt  

Definition:
adenine phosphoribosyltransferase

Gene Start:
1135569

Gene Stop:
1136138

Gene Length:
570

Molecular Weight*:
20887

pI*:
8.13

Net Charge*:
2.10

EC:
2.4.2.7  

Functional Class:
Purines, pyrimidines, nucleosides, and nucleotides; Salvage of nucleosides and nucleotides  

Pathway: pathway table
Nucleotide metabolism; Purine Metabolism
Nucleotide metabolism; Pyrimidine Metabolism

Secondary Evidence:
Allen M, Qin W, Moreau F, Moffatt B.
Adenine phosphoribosyltransferase isoforms of Arabidopsis and their potential contributions to adenine and cytokinin metabolism.
Physiol Plant. 2002 May;115(1):56-68.
PMID: 12010467

Saxild HH, Nygaard P.
Genetic and physiological characterization of Bacillus subtilis mutants resistant to purine analogs.
J Bacteriol. 1987 Jul;169(7):2977-83.
PMID: 3110131

Comment:
This protein catalyzes a salvage reaction resulting in the formation
of AMP, that is energically less costly than de novo synthesis.

Reaction:
AMP + PYROPHOSPHATE = ADENINE + 5-PHOSPHO-ALPHA-D-RIBOSE 1-DIPHOSPHATE.

Blast Summary:  PSI-Blast Search
Gapped BLAST revealed several significant hits to adenine
phosphoribosyltransferase proteins. For example residues 18-185 are
37% similar to adenine phosphoribosyltransferase of Borrelia
burgdorferi,(AE001177).

COGS Summary:  COGS Search
BeTs to 13 clades of COG0503
COG name: Adenine/guanine phosphoribosyltransferases
Functional Class:? F
The phylogenetic pattern of COG0503 is -mtkY-vcEBrHujgpol---
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search
Residues 92-96 and 125-140 represent significant (99%) hits to blocks
BL00103A,B, Purine/pyrimidine phosphoribosyl transferases proteins.
Residues 63-98, 117-162, and 116-161 represent significant (96%) hits
to blocks BL00114C,D, Phosphoribosyl pyrophosphate synthetase proteins.

ProDom Summary:  Protein Domain Search
Residues 17-112 are 46% similar to adenine phosphoribosyltransferase
of APT_MYCGE. Residues 121-166 also support this match.

Paralogs:  Local Blast Search
There is no evidence of paralogs in T. pallidum.

Pfam Summary:  Pfam Search
Residues 36 to 177 (E-value = 3.7e-44) place TP1039 in the Pribosyltran family which is described as Phosphoribosyl transferase domain (PF00156)

Structural Feature(s):
Feature Type  Start  Stop
non-globular  
85  
190

PDB Hit:
none

Gene Protein Sequence:
MRGIGRYHAPVDGHAALDRAIRKRIDFPKKGILYYDITGVLMNAAVFRYC
LDQMVEFYRDEHVTAVAAIESRGFIFAAPFADRMGIPLILVRKAGKLPGD
TYSCSYSLEYGKATVEVHKSDVVAGARVLLTDDLIATGGTLNAARTMLRA
GGAEVVGFFAVVGLPFLRYHELIGDLPVRTLIEYNQETSN

Gene Nucleotide Sequence:  Sequence Viewer
GTGCGTGGTATTGGACGTTACCATGCCCCTGTGGACGGACACGCGGCGCT
GGACCGCGCAATTCGTAAGCGGATTGATTTCCCTAAAAAAGGAATTCTCT
ACTACGACATTACTGGCGTGCTGATGAACGCGGCTGTATTTCGTTACTGT
CTTGATCAAATGGTGGAATTCTACCGCGATGAGCACGTTACCGCGGTCGC
AGCAATCGAATCACGTGGCTTTATTTTTGCCGCGCCTTTTGCAGATCGCA
TGGGAATACCTCTTATTTTAGTTCGGAAGGCGGGGAAACTACCGGGGGAT
ACGTACTCGTGCTCCTATTCCTTAGAGTATGGAAAGGCGACCGTTGAGGT
TCACAAGAGCGATGTAGTCGCGGGGGCCCGCGTGCTGTTAACAGACGACC
TGATTGCCACCGGTGGAACGCTGAATGCAGCGCGCACGATGCTCCGGGCT
GGCGGGGCAGAAGTGGTGGGCTTCTTCGCCGTTGTGGGTTTACCATTCCT
ACGGTACCATGAGCTGATTGGGGATCTTCCCGTGAGAACGCTCATCGAAT
ACAACCAGGAAACTTCCAAT


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy