Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Treponema pallidum Search Results

Record: 1 of 1  
MiniMap IGR765 IGR763 IGR764 IGR762 IGR767 IGR766 IGR768 TP1032 TpF1, - TP1038 hlyIII, - TP1037 TP1033 valS, - TP1035 TP1034 tprL, - TP1031 TP1036 TP1032 TpF1, - TP1038 hlyIII, - TP1037 TP1033 valS, - TP1035 TP1034 tprL, - TP1031 TP1036 Type: tandem, Name:  - 225 Type: tandem, Name:  - 281 Type: tandem, Name:  - 301 TP1032 hlyIII, - TP1037 TP1033 valS, - TP1035 TpF1, - TP1038 TP1034 tprL, - TP1031 TP1036
* Calculated from Protein Sequence

Gene ID: TP1035

DNA Molecule Name:
1  

Genbank ID:
3323365

Gene Name:
valS  

Definition:
valyl-tRNA synthetase

Gene Start:
1131313

Gene Stop:
1128446

Gene Length:
2868

Molecular Weight*:
107360

pI*:
7.24

Net Charge*:
3.44

EC:
6.1.1.9  

Functional Class:
Translation; Amino acyl tRNA synthetases  

Pathway: pathway table
Metabolism of macromolecules; Aminoacyl-tRNA biosynthesis

Secondary Evidence:
Burger A, Brandt B, Süsstrunk U, Thompson CJ, Wohlleben W.
Analysis of a Streptomyces coelicolor A3(2) locus containing the nucleoside diphosphate kinase (ndk) and folylpolyglutamate synthetase (folC) genes.
FEMS Microbiol Lett. 1998 Feb;159(2):283-91.
PMID: 9503623

Luo D, Leautey J, Grunberg-Manago M, Putzer H.
Structure and regulation of expression of the Bacillus subtilis valyl-tRNA synthetase gene.
J Bacteriol. 1997 Apr;179(8):2472-8.
PMID: 9098041

Kulakauskas S, Barsomian JM, Lubys A, Roberts RJ, Wilson GG.
Organization and sequence of the HpaII restriction-modification system and adjacent genes.
Gene. 1994 May;142(1):9-15.
PMID: 7514149

Comment:
Reaction:
ATP + L-VALINE + TRNA(VAL) = AMP + PYROPHOSPHATE + L-VALYL-TRNA(VAL).

Blast Summary:  PSI-Blast Search
Gapped BLAST revealed several significant hits to valyl-tRNA
synthetases. For example residues 14-945 are 40% similar to
valyl-tRNA synthetase of Borrelia burgdorferi,(AE001173).

COGS Summary:  COGS Search
BeTs to 17 clades of COG0525
COG name: Valyl-tRNA synthetase
Functional Class:? J
The phylogenetic pattern of COG0525 is amtkyqvcebrhujgpolinx
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search
Residues 69-79 and 564-573 represent significant (99%) hits to blocks
BL00178A,B, Aminoacyl-transfer RNA synthetases class-I proteins.
Residues 335-354 represent a significant (98%) hit to block PR00488D,
FIVE-LIPOXYGENASE ACTIVATING PROTEIN SIGNATURE. Residues 853-869 and
324-337 represent significant (96%) hits to blocks PR00772B,E,
HEAT LABILE ENTEROTOXIN B CHAIN SIGNATURE.

ProDom Summary:  Protein Domain Search
Residues 76-201 are 55% similar to valyl-tRNA synthetase of SYV_LACCA.
Residues 125-342, 287-327, 642-737, and 834-927 also support this match.

Paralogs:  Local Blast Search
This protein is paralogously related to TP0452, isoleucyl-tRNA
synthetase and TP0586, leucyl-tRNA synthetase. Residues 12-809
are 23% similar to TP0452 and residues 48-787 are 21% similar
to TP0586.

Pfam Summary:  Pfam Search
Residues 22 to 606 (E-value = 9.1e-214) place TP1035 in the tRNA-synt_1 family which is described as tRNA synthetases class I (I, L, M and V) (PF00133)

Structural Feature(s):
Feature Type  Start  Stop
transmembrane  
522  
541
coil-coil  
886  
934

PDB Hit:
none

Gene Protein Sequence:
MTQKLQKIVLPPVYGPADFEARVYACWEQRQAFSPRARGSGTSDSEGCDG
HSRQIEGGARTFVIAIPPPNITGVLHMGHCLNTVLQDIVIRYQRMAGACT
LWIPGTDHAGIATQHVVERALRKEGIHKREVTREQFVARTQQIKDSHQDT
IRMQLRKMGASCDWTCERFTLDAGMSASVREAFVTLYERGLLYRSMYLVN
WCPRCGTALSDDEVFHQEKDGALYYVRYPLLPRTEEEGNGVPPPLGTAQV
GETIIIATTRPETILADVAVAVHPDDARYQSLIGRKVCVPMVNRIVPIIA
DSYVAQDFGTGMVKITPAHDPNDWDIGTRHSLEAINMLNPDGSLNDQVPA
AYRGLSCAQARIQIVADLQAHGLLSREERIVHSVGVCYRCEAVIEPYLSL
QWFVKMKPLASQALAAWKRADVQFHPKKWENTYVRWLEHIRDWCISRQLW
WGHRIPVWYCAQCAQQTVSRVDVQRCAHCGSADITQDPDVLDTWFSSWLW
PFSTLGWPQETQKLRAFYPTSAVITAYDIIFFWVARMIMAGLEFTQTVPF
RDVYLHGLVRDKQGRKMSKSLNNGVDPLHIIRTYGADALRFTLAFMCAQG
QDVLIEMDSFKMGSRFANKVWNASRYILGNLEGRRVYAIAHVSLTELDRW
IFHTFNETVQQVRTALEAYRFNDAAQAVYEFFWNSFCDWYVEASKCSFQK
PDEQEKDRAASVLCTLLEETLRLLHPFLPFVTEEIYRSLSPSVHDTTQAI
PSGAHALLMCAPYPVYVPSRVDARACAHIGAVQEIVRAVRTLRAACGIDP
QKAVSVRLRPSSPAQDANAAAQVSCVHDPGAVARTYEELICVLAGISSLV
YLESDAPKPQVAVATAGTGFELFLVTTEGIDRTMLCARLQKAWQKARQKV
QQVERKLADAQFCTHAPEEVVTAERKKLAEARATCHTLAGYLADMNGKPG
PLSDSD

Gene Nucleotide Sequence:  Sequence Viewer
ATGACCCAAAAACTGCAAAAAATAGTGCTGCCTCCTGTCTATGGGCCTGC
AGATTTTGAAGCGCGTGTCTACGCATGCTGGGAGCAGCGGCAGGCATTTA
GCCCGCGTGCGCGCGGGAGTGGAACGTCGGATAGCGAGGGGTGCGATGGG
CATAGCAGACAGATAGAAGGGGGTGCGCGTACCTTTGTCATTGCTATCCC
ACCGCCAAATATAACGGGCGTACTCCATATGGGGCACTGTCTCAATACGG
TGTTGCAGGATATCGTTATCCGCTACCAGCGCATGGCCGGTGCGTGTACG
CTCTGGATTCCGGGAACTGACCATGCAGGTATTGCCACGCAGCATGTGGT
TGAACGCGCCTTGAGGAAGGAAGGCATCCATAAGCGTGAGGTGACGCGCG
AACAATTCGTTGCACGAACGCAGCAGATAAAGGATTCCCATCAAGACACT
ATTCGCATGCAGTTACGGAAGATGGGGGCATCTTGTGATTGGACCTGTGA
GCGCTTTACGCTTGATGCAGGTATGTCAGCCTCCGTACGCGAAGCGTTCG
TTACGCTTTATGAACGTGGCTTGCTCTATCGTAGCATGTACTTGGTTAAC
TGGTGTCCTCGCTGTGGCACCGCGCTGTCTGACGATGAGGTTTTTCATCA
AGAAAAGGATGGCGCGCTCTATTATGTTCGGTACCCTCTTTTACCCCGTA
CTGAAGAAGAAGGAAACGGCGTTCCCCCTCCATTAGGGACTGCTCAGGTG
GGGGAAACTATCATCATTGCTACTACGCGCCCTGAAACCATTTTGGCAGA
TGTGGCAGTTGCGGTGCATCCAGATGATGCGCGCTACCAATCTTTGATTG
GACGTAAGGTATGCGTGCCAATGGTGAACCGCATTGTTCCTATTATTGCT
GATTCATATGTTGCGCAGGATTTTGGAACCGGTATGGTAAAGATTACTCC
TGCGCACGATCCGAACGACTGGGATATTGGGACGCGCCATTCGCTTGAAG
CGATTAATATGCTCAATCCAGATGGCTCGCTCAATGATCAGGTGCCTGCT
GCGTATCGGGGGCTTTCGTGTGCTCAGGCACGGATACAAATCGTTGCCGA
TTTGCAGGCGCATGGGCTCCTGTCCCGTGAGGAGCGCATAGTGCATTCGG
TGGGAGTGTGTTATCGCTGCGAAGCAGTTATTGAGCCGTATCTTTCTCTG
CAGTGGTTTGTCAAAATGAAACCACTTGCTTCTCAGGCCCTGGCTGCGTG
GAAGCGTGCGGACGTGCAGTTCCATCCTAAGAAATGGGAAAATACCTATG
TGCGGTGGCTTGAGCACATTCGCGACTGGTGTATTTCGCGCCAGCTGTGG
TGGGGACATCGCATCCCGGTGTGGTATTGCGCACAGTGTGCACAGCAAAC
GGTGAGTCGGGTGGATGTGCAGCGCTGTGCTCATTGCGGCAGTGCGGATA
TAACGCAGGATCCTGACGTGTTAGATACGTGGTTTTCCAGTTGGCTGTGG
CCTTTTTCTACTCTTGGGTGGCCTCAGGAAACGCAGAAGCTGCGCGCGTT
TTACCCCACGTCTGCGGTCATTACCGCGTATGACATTATTTTCTTTTGGG
TGGCGCGCATGATAATGGCGGGGCTGGAGTTTACGCAAACGGTTCCTTTT
CGAGATGTGTACCTGCACGGTTTAGTGCGTGACAAGCAGGGAAGAAAGAT
GAGCAAATCACTCAACAACGGGGTGGACCCGCTGCACATTATTCGCACGT
ACGGTGCCGATGCACTGCGTTTTACGCTTGCCTTTATGTGTGCGCAGGGG
CAGGACGTGTTGATAGAAATGGATTCGTTCAAGATGGGTTCGCGGTTTGC
GAATAAGGTGTGGAATGCTTCTCGTTATATTTTGGGCAATCTCGAAGGCA
GGCGGGTGTACGCTATTGCGCACGTGTCTCTAACTGAACTGGATCGCTGG
ATCTTTCACACATTTAATGAAACTGTGCAGCAGGTGCGTACAGCACTTGA
AGCGTACCGTTTTAATGATGCGGCACAGGCAGTGTATGAGTTCTTTTGGA
ACAGCTTTTGTGATTGGTATGTAGAGGCAAGTAAATGCTCGTTTCAGAAA
CCTGATGAACAGGAGAAGGATCGCGCAGCTTCAGTGCTCTGTACCCTTCT
GGAAGAGACGCTGCGACTGCTCCATCCTTTTTTGCCGTTTGTAACAGAAG
AGATTTACCGGTCGCTGTCGCCTTCTGTGCACGATACCACCCAAGCAATT
CCGTCTGGGGCGCACGCGTTGCTCATGTGCGCGCCATATCCGGTGTATGT
GCCGTCGCGGGTAGATGCGCGCGCGTGTGCGCATATAGGTGCGGTGCAGG
AAATAGTGCGTGCGGTGCGTACGCTGCGCGCTGCGTGTGGTATTGATCCG
CAAAAAGCTGTTTCAGTCAGACTGCGTCCGAGTTCTCCGGCGCAGGATGC
GAACGCCGCAGCGCAGGTGTCCTGTGTGCACGATCCGGGAGCGGTGGCGC
GCACATATGAGGAATTGATTTGTGTGTTAGCGGGTATTTCCTCGCTTGTG
TATCTTGAAAGCGATGCGCCTAAACCGCAGGTTGCCGTTGCAACAGCGGG
GACAGGGTTTGAGCTGTTCTTAGTAACGACGGAAGGAATTGACCGGACGA
TGCTGTGCGCGCGTCTTCAAAAAGCGTGGCAGAAGGCGCGGCAAAAAGTG
CAGCAGGTGGAGCGTAAGCTTGCAGACGCGCAGTTTTGCACGCACGCTCC
TGAAGAAGTGGTGACCGCAGAGCGCAAGAAACTGGCAGAGGCGCGCGCAA
CGTGCCACACCCTTGCAGGATATCTTGCGGACATGAATGGAAAGCCTGGA
CCGCTCTCTGACTCCGAT


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy