Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Treponema pallidum Search Results

Record: 1 of 1  
MiniMap IGR763 IGR755 IGR760 IGR758 IGR761 IGR762 IGR759 IGR757 IGR754 IGR756 rpsI, - TP1024 rplM, - TP1025 TP1032 TP1030 TP1029 TP1033 pcrA,uvrD, - TP1028 udp, - TP1027 tprL, - TP1031 TP1026 rpsI, - TP1024 rplM, - TP1025 TP1032 TP1030 TP1029 TP1033 pcrA,uvrD, - TP1028 udp, - TP1027 tprL, - TP1031 TP1026 Type: tandem, Name:  - 281 Type: tandem, Name:  - 223 Type: tandem, Name:  - 224 Type: tandem, Name:  - 280 rpsI, - TP1024 rplM, - TP1025 TP1030 TP1029 TP1033 pcrA,uvrD, - TP1028 TP1032 udp, - TP1027 tprL, - TP1031 TP1026
* Calculated from Protein Sequence

Gene ID: TP1028

DNA Molecule Name:
1  

Genbank ID:
3323356

Gene Name:
pcrA  uvrD  

Definition:
DNA helicase II

Gene Start:
1123041

Gene Stop:
1121032

Gene Length:
2010

Molecular Weight*:
75392

pI*:
7.40

Net Charge*:
4.12

EC:
3.6.1.-  

Functional Class:
Replication; DNA replication, restriction, modification, recombination, and repair  

Pathway: pathway table
Metabolism of cofactors, vitamins, and other substances; Folate biosynthesis
Metabolism of complex carbohydrates; Starch and sucrose metabolism

Comment:
UvrD has both ATPase and helicase activities. Unwinds DNA duplexes with
3' and 5' polarity with respect to the bound strand and initiates
unwinding most effectively when a single-stranded region is present.
Involved in the postincision events of nucleotide excision repair and
methyl-directed mismatch repair.

See TP0102, rep

Blast Summary:  PSI-Blast Search
There are significant hits to many UvrD and DNA helicase II proteins.
For example residues 1-662 are 34% similar to DNA helicase II of
Serratia marcescens, (AF028736).

COGS Summary:  COGS Search
BeTs to 14 clades of COG0210
COG name: Superfamily I DNA and RNA helicases
Functional Class:  L
The phylogenetic pattern of COG0210 is --T-YqvCEBRHUJgPOLinx
Number of proteins in this genome belonging to this COG is 3

Blocks Summary:  Blocks Search
None.

ProDom Summary:  Protein Domain Search
Residues 303-407 are 38% similar to ATP-DEPENDENT DNA HELICASE II of
PCRA_STAAU. Residues 12-71, 81-220, 222-262 and 263-302 are also
significantly matched to ATP-DEPENDENT DNA HELICASE II proteins.

Paralogs:  Local Blast Search
This protein is paralogously related to TP0102, rep helicase, single-
stranded DNA-dependent ATPase and TP0898, ATP-dependent nuclease,
subunit A. Residues 5-666 are 33% similar to TP0102. Residues 3-119
180-267 and 348-433 are significant matches to TP0898.

Pfam Summary:  Pfam Search
Residues 8 to 494 (E-value = 9.8e-209) place TP1028 in the UvrD-helicase family which is described as UvrD/REP helicase (PF00580)

Structural Feature(s):
Feature Type  Start  Stop
non-globular  
420  
520

PDB Hit:
none

Gene Protein Sequence:
MESYLSALNEAQRQAVCHYGSPLLILAGAGSGKTRVITTKIAHLIRSRQV
RPEQILAVTFTNKAAREMRTRACALESAAQGATICTFHALGVWILRRYAV
RLGLNPHFSIYDDHDVRALLPKILPHCDHSRAGMLARGISQAKDYGLDCA
SFESVHARVSAPACAARAVLGDRQFAHAYACYHRRMREMGTVDFGDLIML
PVQLLREHQDVAEQLHARWQVVMVDEYQDSNVAQFHFLQVLTGAHTYLCV
VGDDDQSIYRFRGAEVKNILTFPEFFQNTQIIRLEYNYRSTDAILRVADS
VVKKNQDRLGKALIAQRTGGTKPRLFLLNNQDEEAALCVHLIQEARARGI
PYADWAILYRVNAQSLSFEQCFLRNRIPYRIVGTLKFYSRAEVKDVLAFL
QLIVNGSDELALRRVLNKPPRGIGEKTQDALFVCAQQAAITDFTTLQSTH
LTALGTRARQKVSSFLSLLRALRARMPQAPAAGEEARTSAPPEEPVEERT
HDAEGLARFVSVVMEHTGLEEWYRQKDEEEGTQCAVNVQELMNAASLYAC
SHEGLVSFLEHIQLDQNMADEGGAADAVHLITIHNTKGLEFRRVILTGLE
NGVFPRDDEADIQEERRLMYVACTRAMDSLYLTACAYRRMWGRHTAMKPS
RFLTELDSALLEITDPRHFA

Gene Nucleotide Sequence:  Sequence Viewer
GTGGAATCCTACCTGAGCGCGCTCAATGAGGCGCAGCGTCAGGCCGTTTG
CCATTATGGCAGCCCGCTTCTTATCCTTGCCGGCGCAGGCTCAGGAAAGA
CGCGCGTTATCACCACCAAAATCGCCCATCTTATCCGTTCCCGGCAGGTT
CGCCCCGAGCAGATTCTGGCAGTAACCTTTACCAATAAAGCGGCGCGTGA
GATGCGCACGCGTGCCTGCGCGCTTGAGTCTGCCGCGCAGGGGGCAACTA
TCTGTACCTTCCACGCACTGGGGGTGTGGATCCTGCGTCGCTATGCAGTC
CGTCTGGGATTGAACCCCCATTTTAGTATTTATGACGACCATGACGTCCG
TGCACTCTTGCCAAAAATCCTGCCTCATTGCGATCACAGTCGGGCAGGCA
TGCTCGCGCGTGGAATTTCTCAGGCAAAGGACTATGGGCTCGACTGCGCC
TCGTTTGAGTCAGTGCACGCGCGTGTCTCCGCTCCTGCATGCGCTGCCAG
AGCCGTTCTGGGTGACAGGCAGTTTGCGCACGCATATGCGTGCTACCATC
GGCGTATGCGCGAAATGGGAACGGTAGACTTTGGGGATCTGATTATGCTT
CCGGTGCAGCTCTTGCGTGAGCACCAGGACGTCGCCGAACAGCTGCATGC
ACGGTGGCAGGTGGTCATGGTAGATGAGTATCAAGACTCAAACGTGGCGC
AGTTTCATTTCTTGCAGGTGCTCACCGGTGCGCACACCTATCTTTGTGTG
GTAGGGGACGACGATCAGTCCATCTATCGCTTTCGCGGAGCAGAGGTAAA
AAATATCTTGACCTTCCCTGAGTTCTTTCAAAATACCCAGATTATCCGCC
TGGAGTACAACTACCGGTCCACAGACGCAATTCTGCGTGTTGCTGATTCG
GTAGTGAAAAAAAACCAAGACCGCTTAGGAAAGGCGCTGATTGCCCAGCG
CACGGGAGGTACTAAGCCGCGCCTGTTCTTGCTGAATAATCAAGATGAAG
AAGCTGCGCTGTGCGTGCACCTCATTCAAGAAGCGCGTGCGCGCGGCATC
CCATACGCGGATTGGGCGATTTTATATCGGGTAAATGCACAGTCGCTGAG
TTTTGAACAGTGTTTTTTGCGGAATCGCATTCCGTATCGCATTGTCGGCA
CGCTCAAATTCTACAGTCGCGCAGAGGTAAAAGACGTGCTGGCGTTTCTC
CAGCTCATAGTCAATGGCTCAGATGAACTGGCCCTCCGGCGGGTGCTGAA
TAAGCCGCCTCGGGGCATTGGAGAAAAGACACAAGACGCATTGTTTGTCT
GTGCACAGCAGGCAGCCATAACTGATTTTACCACACTCCAGTCCACCCAC
CTGACCGCGCTTGGCACGCGTGCGCGGCAAAAGGTCAGTAGCTTTCTGTC
GCTGTTACGTGCGCTGCGTGCACGCATGCCACAGGCCCCCGCAGCGGGAG
AAGAAGCTCGCACCAGTGCGCCGCCTGAGGAGCCGGTAGAGGAGCGCACC
CACGATGCAGAAGGACTTGCGCGCTTTGTTTCTGTGGTAATGGAACACAC
GGGGCTGGAAGAATGGTATCGACAGAAGGATGAGGAAGAAGGGACGCAGT
GCGCGGTCAACGTGCAGGAGTTAATGAACGCAGCGTCACTGTATGCATGT
TCGCATGAGGGGTTAGTGAGTTTCCTAGAACACATCCAATTGGACCAAAA
TATGGCCGACGAGGGAGGAGCGGCTGACGCAGTGCACTTGATCACCATTC
ACAATACAAAAGGGCTGGAGTTTCGACGGGTGATTCTGACCGGACTAGAG
AACGGGGTGTTTCCGCGTGATGACGAAGCAGATATACAGGAAGAGCGGCG
TTTGATGTACGTTGCCTGCACGCGGGCTATGGATAGCTTATACCTTACCG
CGTGTGCGTACCGCAGAATGTGGGGACGACACACGGCGATGAAGCCCAGC
CGCTTTTTGACCGAGCTTGACTCCGCGCTGTTAGAAATAACCGATCCGCG
ACACTTTGCC


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy