Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Treponema pallidum Search Results

Record: 1 of 1  
MiniMap IGR755 IGR760 IGR758 IGR753 IGR759 IGR752 IGR757 IGR754 IGR756 rpsI, - TP1024 rplM, - TP1025 recX, - TP1023 TP1030 TP1029 sms,radA, - TP1022 pcrA,uvrD, - TP1028 udp, - TP1027 gatB, - TP1021 TP1026 rpsI, - TP1024 rplM, - TP1025 recX, - TP1023 TP1030 TP1029 sms,radA, - TP1022 pcrA,uvrD, - TP1028 udp, - TP1027 gatB, - TP1021 TP1026 Type: tandem, Name:  - 223 Type: tandem, Name:  - 224 Type: tandem, Name:  - 280 rpsI, - TP1024 rplM, - TP1025 recX, - TP1023 TP1029 sms,radA, - TP1022 pcrA,uvrD, - TP1028 TP1030 udp, - TP1027 gatB, - TP1021 TP1026
* Calculated from Protein Sequence

Gene ID: TP1026

DNA Molecule Name:
1  

Genbank ID:
3323354

Gene Name:


Definition:
oligoendopeptidase

Gene Start:
1118346

Gene Stop:
1120112

Gene Length:
1767

Molecular Weight*:
68784

pI*:
6.57

Net Charge*:
-6.36

EC:
3.4.24.-  

Functional Class:
Translation; Degradation of proteins, peptides, and glycopeptides  

Pathway: pathway table
Miscellaneous Enzymes

Comment:
Oligopeptidase F hydrolyzes peptides containing between 7 and 17 amino
acids with a rather wide specificity.

Blast Summary:  PSI-Blast Search
Gapped BLAST revealed several significant hits to oligopeptidases.
For example residues 58-499 are 21% similar to oligoendopeptidase of
Bacillus subtilis,(Z99110).

COGS Summary:  COGS Search
BeTs to 6 clades of COG1164
COG name: Oligoendopeptidase F
Functional Class:  E
The phylogenetic pattern of COG1164 is ------v--B--ujgpolin-
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search
Residues 324-334 represent a significant (99%) hit to block PR00285C,
SCORPION TOXIN SIGNATURE. Residues 354-364 and 430-440 represent
significant (98%) hits to block BL00142, Neutral zinc metallopeptidases,
zinc-binding region proteins. Residues 575-586 represent a significant
(95%) hit to block PR00226E, GEMINIVIRUS MSV 27KD COAT PROTEIN SIGNATURE.

ProDom Summary:  Protein Domain Search
Residues 159-416 are 23% similar to oligoendopeptidase F of PEPF_LACLA.

Paralogs:  Local Blast Search
There is no evidence of paralogs in T. pallidum.

Pfam Summary:  Pfam Search
Residues 165 to 576 (E-value = 4.1e-09) place TP1026 in the Peptidase_M3 family which is described as Peptidase family M3 (PF01432)

Structural Feature(s):
Feature Type  Start  Stop
non-globular  
191  
284

PDB Hit:
none

Gene Protein Sequence:
MQRFEDIPYTRPHMDILEHAVDAAHGEFAQARCARDAYASILAIEDLQRQ
YLTAQALANMRCSIDTRNTFYRREQDFFDAVHPRFARLDHAFNQLLLASP
QRDGLEKLIGTHRFTLARLQSKTFCSEIMEDLAEENRLTSAYETLLASAH
ILFRGHHYTLAQLSPFMEHTDRNTRRDAHEAYYHFFAQHESELDTLYDTL
VRVRTRIARTLGYDNYIQLGYDRLLRSDYDMQDIARYRTYILRYAVPLAA
ELHEQQRSRLGLSELLFYDEPLYFPSGNPVPQGDAPWILNQAACMYRELS
PETDQFFTFMREYHLFDVCARIAKASGGYCTTLSTYRAPFIFANFNRTAH
DVEVMTHEVGHAFQAYQRYRARLDPCLEAYVWPTYEACEIPSMSMEFLTW
PWMGLFFGEQKERFYLRHLTQAVELLPYGAAVDEFQHWVYAHADASATER
KKAWRALETQYLPRRRYGGQHYLSCGGLWMRQSHIFCIPFYYIDYTLAQI
CALQFWDRSRVAYTHLSTLTGAAPYASITPTAYAEAWHDYCVLCSRGGSE
PFMRLLATANLHNPFEEDTFVSTLASCRAYFRTVGDRLS

Gene Nucleotide Sequence:  Sequence Viewer
ATGCAAAGATTTGAAGACATTCCGTACACGCGGCCACACATGGACATACT
CGAGCATGCCGTCGACGCGGCTCATGGGGAGTTCGCGCAGGCCCGTTGTG
CACGCGATGCGTATGCGTCTATACTCGCCATAGAGGATCTCCAGCGCCAA
TATCTTACCGCACAGGCACTAGCGAACATGCGCTGTTCCATTGATACACG
CAACACCTTTTACCGCAGAGAACAGGATTTCTTCGATGCTGTACATCCTC
GCTTTGCCCGCTTAGATCATGCCTTCAACCAGCTGCTGCTTGCATCACCA
CAGCGCGACGGTCTTGAAAAACTTATTGGCACTCACCGCTTTACCCTTGC
ACGCCTTCAGAGCAAAACCTTCTGCTCGGAGATTATGGAAGACCTCGCAG
AAGAAAATCGTCTCACCAGCGCCTATGAAACACTCCTCGCTTCCGCACAC
ATTCTCTTCCGAGGCCACCACTACACTCTCGCCCAGCTGTCCCCCTTTAT
GGAACACACCGACCGCAACACGCGGCGCGACGCGCATGAGGCATACTATC
ACTTCTTTGCTCAACATGAATCGGAGCTCGATACCCTCTATGACACGCTG
GTACGAGTGCGCACACGCATCGCACGCACGCTCGGCTATGACAATTACAT
CCAACTCGGCTATGACCGCCTGTTACGCAGCGACTACGATATGCAAGATA
TTGCGCGTTACCGCACCTACATCCTGCGCTACGCCGTACCCCTCGCTGCG
GAACTACATGAACAACAGCGATCTCGACTTGGACTCAGTGAACTTCTCTT
TTATGACGAGCCGTTGTACTTCCCTTCTGGAAATCCAGTTCCCCAGGGAG
ATGCACCCTGGATATTGAATCAGGCCGCTTGTATGTACCGCGAACTGTCC
CCAGAAACAGACCAGTTCTTTACCTTTATGCGCGAGTACCACCTATTTGA
TGTCTGTGCACGTATTGCAAAAGCGAGCGGTGGATACTGCACAACCTTGA
GCACATATCGTGCGCCTTTTATTTTTGCAAACTTTAATCGCACTGCACAT
GACGTGGAGGTTATGACGCACGAGGTGGGCCACGCCTTCCAAGCCTACCA
ACGCTATCGAGCGCGTCTTGATCCCTGTTTGGAAGCGTATGTGTGGCCCA
CGTACGAAGCGTGCGAGATCCCCTCAATGAGTATGGAATTTCTCACCTGG
CCGTGGATGGGGCTCTTTTTTGGTGAACAGAAAGAACGCTTCTACCTGCG
CCATTTAACACAGGCAGTGGAGCTTTTACCGTACGGGGCAGCTGTGGACG
AATTCCAACACTGGGTGTACGCACATGCGGACGCTTCTGCCACTGAACGC
AAGAAGGCGTGGCGCGCATTAGAAACTCAGTATTTACCTCGCCGTCGGTA
CGGAGGGCAGCACTACTTGTCCTGCGGGGGACTGTGGATGCGTCAAAGTC
ACATTTTCTGTATACCCTTTTACTACATAGACTACACGCTCGCGCAGATA
TGTGCGTTGCAATTTTGGGATCGCAGCCGCGTTGCATACACTCACCTTTC
TACTCTCACCGGCGCGGCACCGTACGCCAGCATAACTCCTACTGCCTATG
CGGAAGCCTGGCATGACTATTGCGTACTGTGCAGCCGAGGCGGCAGCGAA
CCGTTCATGCGTCTGCTTGCCACAGCGAATCTGCACAACCCCTTTGAGGA
AGACACGTTTGTTTCAACACTCGCTTCCTGCCGTGCGTATTTTCGCACGG
TTGGTGACCGCCTTTCC


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy