Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Treponema pallidum Search Results

Record: 1 of 1  
MiniMap IGR755 IGR758 IGR753 IGR752 IGR757 IGR754 IGR756 rpsI, - TP1024 rplM, - TP1025 recX, - TP1023 sms,radA, - TP1022 pcrA,uvrD, - TP1028 udp, - TP1027 gatB, - TP1021 TP1026 rpsI, - TP1024 rplM, - TP1025 recX, - TP1023 sms,radA, - TP1022 pcrA,uvrD, - TP1028 udp, - TP1027 gatB, - TP1021 TP1026 Type: tandem, Name:  - 223 rpsI, - TP1024 rplM, - TP1025 recX, - TP1023 sms,radA, - TP1022 pcrA,uvrD, - TP1028 udp, - TP1027 gatB, - TP1021 TP1026 gatA,gluA, - TP1020 gatA,gluA, - TP1020
* Calculated from Protein Sequence

Gene ID: TP1024

DNA Molecule Name:
1  

Genbank ID:
3323359

Gene Name:
rpsI  

Definition:
30S ribosomal protein S9

Gene Start:
1117469

Gene Stop:
1117083

Gene Length:
387

Molecular Weight*:
14236

pI*:
12.12

Net Charge*:
18.13

EC:
 

Functional Class:
Translation; Ribosomal proteins  

Pathway: pathway table
Molecular assembly; Ribosome assembly

Secondary Evidence:
Sanchez C, Blanco G, Mendez C, Salas JA.
Cloning, sequencing and transcriptional analysis of a Streptomyces coelicolor operon containing the rplM and rpsI genes encoding ribosomal proteins ScoL13 and ScoS9.
Mol Gen Genet. 1997 Dec;257(1):91-6.
PMID: 9439573


Comment:


Blast Summary:  PSI-Blast Search
Gapped BLAST revealed several significant hits to ribosomal protein S9
proteins. For example residues 3-129 are 55% similar to ribosomal
rotein S9 of Borrelia burgdorferi,(AE001140).

COGS Summary:  COGS Search
BeTs to 17 clades of COG0103
COG name: Ribosomal protein S9
Functional Class:? J
The phylogenetic pattern of COG0103 is amtkYqvcebrhujgpolinx
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search
Residues 9-30, 7-28, 51-86, and 103-129 represent significant (100%)
hits to blocks BL00360A,B,C, Ribosomal protein S9 proteins. Residues
73-91 represent a significant (98%) hit to block BL01288G, Uncharacterized
protein family UPF0027 proteins.

ProDom Summary:  Protein Domain Search
Residues 25-86 are 51% similar to ribosomal protein S9 of RS9_BACST.
Residues 94-121 also support this match.

Paralogs:  Local Blast Search
There is no evidence of paralogs in T. pallidum.

Pfam Summary:  Pfam Search
Residues 9 to 129 (E-value = 2.2e-45) place TP1024 in the Ribosomal_S9 family which is described as Ribosomal protein S9/S16 (PF00380)

Structural Feature(s):
Feature Type  Start  Stop
non-globular  
45  
129

PDB Hit:
none

Gene Protein Sequence:
MKNLGIGTGRRKTAVARVCIRMGNGNVTVNRRDVGAYFPTAEQLRRVREP
LFATANERRYDVIVNVYGGGLDGQAGACAHGIARALVRADASNQASLRAG
GLLTRDSRMVERKKYGQRGARRRFQFSKR

Gene Nucleotide Sequence:  Sequence Viewer
GTGAAGAATCTTGGGATCGGAACAGGGAGAAGGAAAACGGCTGTCGCTCG
CGTGTGTATCCGTATGGGGAACGGGAATGTTACCGTCAACAGACGGGATG
TCGGCGCGTATTTTCCTACGGCGGAGCAATTGCGTCGGGTGCGCGAACCC
CTCTTCGCTACCGCGAACGAGCGGCGTTACGATGTGATTGTCAATGTGTA
TGGCGGCGGACTTGACGGGCAGGCTGGTGCGTGTGCGCATGGTATTGCGC
GCGCTCTCGTGCGTGCTGACGCTTCAAATCAGGCTTCGCTGCGTGCAGGT
GGGTTGCTCACGCGTGATTCTCGCATGGTAGAGCGCAAGAAGTATGGCCA
GCGCGGTGCACGGCGTAGATTTCAATTCAGTAAGCGA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy