Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Treponema pallidum Search Results

Record: 1 of 1  
MiniMap IGR751 IGR755 IGR750 IGR753 IGR752 IGR754 IGR749 IGR756 rpsI, - TP1024 rplM, - TP1025 recX, - TP1023 sms,radA, - TP1022 alaS, - TP1017 gatC, - TP1019 TP1018 gatB, - TP1021 TP1026 rpsI, - TP1024 rplM, - TP1025 recX, - TP1023 sms,radA, - TP1022 alaS, - TP1017 gatC, - TP1019 TP1018 gatB, - TP1021 TP1026 Type: tandem, Name:  - 279 rpsI, - TP1024 rplM, - TP1025 recX, - TP1023 sms,radA, - TP1022 alaS, - TP1017 gatC, - TP1019 TP1018 gatB, - TP1021 TP1026 gatA,gluA, - TP1020 gatA,gluA, - TP1020
* Calculated from Protein Sequence

Gene ID: TP1021

DNA Molecule Name:
1  

Genbank ID:
3323348

Gene Name:
gatB  

Definition:
glu-tRNA amidotransferase subunit B/ PET112-like protein

Gene Start:
1113419

Gene Stop:
1114945

Gene Length:
1527

Molecular Weight*:
56855

pI*:
6.77

Net Charge*:
-1.97

EC:
6.3.5.-  

Functional Class:
Translation; tRNA modification  

Pathway: pathway table
Metabolism of macromolecules; Aminoacyl-tRNA biosynthesis

Comment:
In Saccharomyces cerevisiae, PET112 is required to maintain Rho+
mitochondrial DNA. It plays some unknown role in the expression of
mitochondrial genes generally, probably at the level of translation.

This protein may have an extra N-terminal region.

Blast Summary:  PSI-Blast Search
Gapped BLAST revealed several significant hits to glu-tRNA
amidotransferase subunit B and PET112-like proteins. For example
residues 26-509 are 44% similar to glu-tRNA amidotransferase, subunit
B of Borrelia burgdorferi,(AE001140). Residues 26-508 are 43% similar
to PET112 of Synechocystis sp.,(D90913).

COGS Summary:  COGS Search
BeTs to 16 clades of COG0064
COG name: Glu-tRNAGln amidotransferase B subunit (PET112 homolog)
Functional Class:  J
The phylogenetic pattern of COG0064 is AMTkyqvc-br-ujgpolinx
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search
Residues 99-116, 141-153, 165-196, 213-223, and 236-267 represent
significant (100%) hits to blocks BL01234A,B,C,D,E, PET112 family
proteins.

ProDom Summary:  Protein Domain Search
Residues 31-309 are 42% similar to YZDD_BACSU, a PET112-like protein.
Residues 361-492 and 375-506 also support this match.

Paralogs:  Local Blast Search
There is no evidence of paralogs in T. pallidum.

Pfam Summary:  Pfam Search
Residues 24 to 266 (E-value = 1.3e-158) place TP1021 in the GatB_N family which is described as PET112 family, N terminal region (PF02934)
Residues 289 to 357 (E-value = 6.3e-29) place TP1021 in the GatB family which is described as PET112 family, C terminal region (PF01162)
Residues 359 to 506 (E-value = 6.2e-65) place TP1021 in the GatB_Yqey family which is described as GatB/Yqey domain (PF02637)

Structural Feature(s):
Feature Type  Start  Stop
non-globular  
48  
91
non-globular  
358  
417

PDB Hit:
none

Gene Protein Sequence:
MSDLQTGTVPSIAGATDDTHAAPFFYEVIIGCEIHCQLLTKTKAFCACAN
RSGGMPNSRVCPVCLGLPGALPVVSEEYVRLGVRAGLALGCTIQLWSAFD
RKHYFYPDLPKGYQITQYDAPLCTDGAVDVQGVDMPVQRRVRIERIHLEE
DAGKSLHAADAYSYIDFNRCGVPLIEIVSRPDLRSAEEAACFMQTIREIL
TFIEVTDGNLEEGALRCDANVNVRILYKGQEHHTPISEIKNMNSYRMVRD
ACTYEVQRQLQEFWQKGPASKEEMQRKRTMGWDPVEGVTLLQRTKHSLRD
YRFMRDPDLPDLHLTPAYVQHLSYTVGELPAARRARFKLDLGLSAFAAQT
LTGSRMLADWFEKAAHASKNARRVANWILSEVLAVVNEKNICIAELNLSP
EAIAELMDAVEDQRITGKQAKDIFAQMLATGARAQDIISAQGLAQLSDEE
EIATLVQTVFQEHPKALRDWQHGKTNVAAWLMGQVMKRSRGRAHPARVAT
LVHQALSQL

Gene Nucleotide Sequence:  Sequence Viewer
ATGTCTGACCTCCAAACAGGCACAGTTCCCTCCATTGCAGGCGCCACAGA
TGACACACATGCCGCACCCTTTTTCTACGAGGTAATTATTGGCTGTGAAA
TTCATTGTCAGCTTCTAACAAAGACCAAAGCTTTCTGTGCCTGTGCAAAT
CGCTCAGGAGGAATGCCGAATAGCCGTGTGTGTCCTGTGTGTCTTGGGTT
GCCAGGAGCGTTGCCCGTTGTGAGTGAAGAGTACGTGCGGCTCGGGGTGC
GCGCCGGACTTGCGTTGGGGTGCACTATCCAGCTTTGGTCCGCTTTTGAT
CGCAAGCACTATTTTTATCCAGATCTCCCAAAGGGTTATCAAATTACCCA
GTACGACGCTCCCTTGTGTACGGATGGTGCAGTGGATGTACAGGGAGTTG
ACATGCCCGTGCAGCGGCGTGTCCGTATTGAACGGATACATTTGGAGGAG
GACGCAGGCAAAAGCCTGCATGCTGCAGACGCTTACAGCTATATTGATTT
CAATCGTTGTGGGGTGCCGCTCATTGAAATTGTATCTAGGCCGGATCTGC
GCTCTGCAGAGGAGGCCGCATGTTTTATGCAGACGATCCGCGAGATTCTC
ACCTTTATCGAGGTAACGGATGGTAATTTAGAAGAAGGCGCACTGCGATG
CGACGCGAATGTTAATGTGAGGATTCTGTACAAAGGGCAAGAACACCACA
CTCCCATTTCTGAAATCAAAAATATGAACTCGTATCGTATGGTGCGGGAC
GCGTGTACGTATGAGGTACAGCGTCAATTGCAGGAGTTTTGGCAAAAGGG
TCCTGCGAGCAAAGAAGAGATGCAGAGAAAACGCACGATGGGCTGGGATC
CGGTCGAAGGGGTTACGCTTTTACAGCGTACAAAGCACTCACTGCGCGAT
TATCGTTTCATGCGCGATCCAGACTTACCTGACCTGCACTTGACCCCTGC
ATATGTCCAGCATCTCTCTTACACAGTCGGGGAACTTCCGGCAGCGCGGC
GTGCACGTTTCAAACTTGACCTTGGCTTGTCGGCGTTTGCAGCCCAAACG
CTTACCGGCAGCCGCATGCTCGCAGACTGGTTTGAGAAGGCAGCGCATGC
GTCTAAGAATGCGCGACGAGTGGCAAACTGGATTCTGTCGGAGGTTCTTG
CGGTAGTAAACGAGAAGAATATCTGCATTGCAGAGCTCAATCTGAGTCCT
GAAGCAATTGCCGAACTAATGGATGCAGTTGAAGATCAGCGCATTACCGG
AAAACAAGCAAAGGATATATTTGCACAAATGCTTGCCACCGGTGCGCGAG
CGCAGGACATTATCTCCGCACAGGGTCTGGCACAACTTTCAGATGAGGAA
GAAATCGCAACGTTAGTGCAGACGGTGTTTCAAGAACATCCAAAGGCACT
GCGTGATTGGCAACACGGTAAGACAAACGTGGCTGCCTGGCTCATGGGGC
AAGTAATGAAGCGTTCCCGCGGGCGCGCACACCCTGCGCGAGTGGCGACG
CTCGTCCACCAAGCACTCTCTCAGCTG


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy