Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Treponema pallidum Search Results

Record: 1 of 1  
MiniMap IGR751 IGR750 IGR753 IGR748 IGR752 IGR749 nusB, - TP1015 recX, - TP1023 tpn39b,bmp, - TP1016 sms,radA, - TP1022 alaS, - TP1017 gatC, - TP1019 TP1018 gatB, - TP1021 nusB, - TP1015 recX, - TP1023 tpn39b,bmp, - TP1016 sms,radA, - TP1022 alaS, - TP1017 gatC, - TP1019 TP1018 gatB, - TP1021 Type: tandem, Name:  - 279 recX, - TP1023 tpn39b,bmp, - TP1016 sms,radA, - TP1022 alaS, - TP1017 nusB, - TP1015 gatC, - TP1019 TP1018 gatB, - TP1021 gatA,gluA, - TP1020 gatA,gluA, - TP1020
* Calculated from Protein Sequence

Gene ID: TP1019

DNA Molecule Name:
1  

Genbank ID:
3323346

Gene Name:
gatC  

Definition:
hypothetical protein/ possible glu-tRNA amidotransferase, subunit C

Gene Start:
1111462

Gene Stop:
1111902

Gene Length:
441

Molecular Weight*:
15988

pI*:
4.93

Net Charge*:
-5.28

EC:
6.3.5.-  

Functional Class:
Hypothetical  
Translation; tRNA modification  

Pathway: pathway table
Metabolism of macromolecules; Aminoacyl-tRNA biosynthesis

Comment:
See TP1020, glu-tRNA amidotransferase, subunit A
See TP1021, glu-tRNA amidotransferase, subunit B

Blast Summary:  PSI-Blast Search
Gapped BLAST no significant hits in the database. Subthreshold hits
to the C-terminal region include glu-tRNA amidotransferase, subunit C
of Borrelia burgdorferi,(AE001140).

COGS Summary:  COGS Search
BeTs to 3 clades of COG0721
COG name: Glu-tRNAGln amidotransferase C subunit
Functional Class:  J
The phylogenetic pattern of COG0721 is amt--qvc-br-ujgpolinx
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search
None.

ProDom Summary:  Protein Domain Search
None.

Paralogs:  Local Blast Search
There is no evidence of paralogs in T. pallidum.

Pfam Summary:  Pfam Search
No significant hits to the Pfam 11.0 database

PDB Hit:
none

Gene Protein Sequence:
MHGRPCRFASAAVTLLPPYSSPAILVNKAHGSIMAQQRITSDIFAQLLTL
SHLESSECAVGLATQIEDIIQYFSVVEQFDPGPRDDPDTDNAQGRCSQGN
KIDVDCCPDWVRKDVALPGLSVHDLKRLSTEFADGYFRAPRALDGSA

Gene Nucleotide Sequence:  Sequence Viewer
GTGCACGGGCGTCCGTGCAGGTTTGCATCGGCTGCAGTGACTCTCCTACC
TCCCTATTCTAGTCCGGCGATATTGGTCAACAAGGCACATGGGAGTATCA
TGGCACAACAGCGTATTACGTCTGATATCTTTGCTCAGCTGCTCACCCTT
TCTCACCTCGAAAGCAGCGAGTGTGCAGTAGGACTTGCAACACAGATCGA
GGACATTATCCAGTATTTTTCCGTTGTAGAACAGTTCGACCCCGGTCCAC
GCGACGATCCTGACACGGATAACGCACAAGGCCGTTGCTCCCAGGGGAAT
AAAATTGACGTGGACTGCTGCCCGGACTGGGTACGCAAGGATGTCGCATT
ACCTGGTCTTTCCGTTCACGATCTCAAGCGGTTGTCCACAGAGTTTGCTG
ACGGTTACTTTCGCGCACCGCGCGCGCTCGATGGTAGCGCA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy