Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Treponema pallidum Search Results

Record: 1 of 1  
MiniMap IGR751 IGR747 IGR750 IGR748 IGR749 IGR746 sigA,rpoD, - TP1012 tpn39b,bmp, - TP1016 alaS, - TP1017 TP1014 groES, - TP1013 gatC, - TP1019 TP1018 gatB, - TP1021 sigA,rpoD, - TP1012 tpn39b,bmp, - TP1016 alaS, - TP1017 TP1014 groES, - TP1013 gatC, - TP1019 TP1018 gatB, - TP1021 Type: tandem, Name:  - 279 sigA,rpoD, - TP1012 tpn39b,bmp, - TP1016 alaS, - TP1017 TP1014 nusB, - TP1015 nusB, - TP1015 groES, - TP1013 gatC, - TP1019 TP1018 gatB, - TP1021 gatA,gluA, - TP1020 gatA,gluA, - TP1020
* Calculated from Protein Sequence

Gene ID: TP1017

DNA Molecule Name:
1  

Genbank ID:
3323345

Gene Name:
alaS  

Definition:
alanyl-tRNA synthetase

Gene Start:
1109754

Gene Stop:
1107940

Gene Length:
1815

Molecular Weight*:
67179

pI*:
6.97

Net Charge*:
-0.32

EC:
6.1.1.7  

Functional Class:
Translation; Amino acyl tRNA synthetases  

Pathway: pathway table
Metabolism of macromolecules; Aminoacyl-tRNA biosynthesis

Secondary Evidence:
Jovanovic M, Lilic M, Janjusevic R, Jovanovic G, Savic DJ, Milija J.
tRNA synthetase mutants of Escherichia coli K-12 are resistant to the gyrase inhibitor novobiocin.
J Bacteriol. 1999 May;181(9):2979-83.
PMID: 10217798

Klenk HP, Meier TD, Durovic P, Schwass V, Lottspeich F, Dennis PP, Zillig W.
RNA polymerase of Aquifex pyrophilus: implications for the evolution of the bacterial rpoBC operon and extremely thermophilic bacteria.
J Mol Evol. 1999 May;48(5):528-41.
PMID: 10198119

Guiliani N, Bengrine A, Borne F, Chippaux M, Bonnefoy V.
Alanyl-tRNA synthetase gene of the extreme acidophilic chemolithoautotrophic Thiobacillus ferrooxidans is highly homologous to alaS genes from all living kingdoms but cannot be transcribed from its promoter in Escherichia coli.
Microbiology. 1997 Jul;143 ( Pt 7):2179-87.
PMID: 9245807

Comment:
Reaction:
ATP + L-ALANINE + TRNA(ALA) = AMP + PYROPHOSPHATE + L-ALANYL-TRNA(ALA).

Blast Summary:  PSI-Blast Search
Gapped BLAST revealed several significant hits to alanyl-tRNA synthetases.
For example residues 8-598 are 55% similar to alanyl-tRNA synthetase
of Borrelia burgdorferi,(AE001132).

COGS Summary:  COGS Search
BeTs to 17 clades of COG0013
COG name: Alanyl-tRNA synthetase
Functional Class:? J
The phylogenetic pattern of COG0013 is amtKYqVcebrhujgpolinx
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search
None.

ProDom Summary:  Protein Domain Search
Residues 10-432 are 41% similar to alanyl-tRNA synthetase of
SYA_THIFE. Residues 458-597 also support this match.

Paralogs:  Local Blast Search
This protein is paralogously related to TP0837, threonyl-tRNA
synthetase. Residues 463-570 are 26% similar to TP0837.

Pfam Summary:  Pfam Search
Residues 9 to 604 (E-value = 1.2e-170) place TP1017 in the tRNA-synt_2c family which is described as tRNA synthetases class II (A) (PF01411)

Structural Feature(s):
Feature Type  Start  Stop
coil-coil  
347  
382

PDB Hit:
none

Gene Protein Sequence:
MSIPIRADQLRSRYLAFFSQKAHVVISGKSLVPEHDPTVLFTTAGMHPLV
PYLMGEPHPAGTRLVNAQKCLRTGDIDAVGDNSHLTFFEMLGNWSLGDYF
KEEAIAFSFEFLTGAPWLGISPDRLSVTVFAGDEAVARDEESAAIWERLG
IARTHIHFLPRADNWWGPTGETGPCGPDTEIFFDTGVPPCSVSCRPGCSC
GKYVEIWNDVFMQYRKDADGRYRPLERYCVDTGMGIERTVAVLQGKRSVY
DTEIFTPLLERIGQLCGKRYGCQGAHDVSMRIVCDHIRAATFILGDPVPV
RPSNVGAGYVLRRIIRRSVRHGRKLGIDGEFLSSLARVVIGQYAAVYPEL
EEKATCIAQELANEERKFLDALRKGEAEYERMIPKFLQGTEREIPGSVAF
RLYDTYGFPLELTEELARESGLRVDRAGFDTAFQAHQACSRIGAQRVFKG
GLADHSAETTAYHTATHLLHQALRVVLGTHVQQKGSNITAERLRFDFSHP
RPMSAQEKVQVEQLVNEQIRADLPVCCEVMSLEDAMNSGAVALFGEKYES
TVKVYSIGTFSREVCGGPHVARTGQLGRFSIQKEQSSAAGVRRIRAILEK
SGEKS

Gene Nucleotide Sequence:  Sequence Viewer
ATGAGCATTCCTATTCGCGCCGATCAGCTACGCTCGCGTTATCTCGCCTT
CTTTAGCCAGAAGGCTCATGTGGTTATCTCGGGTAAGTCCCTTGTGCCCG
AGCACGATCCTACCGTGCTTTTTACTACTGCTGGCATGCATCCGTTGGTT
CCCTATCTTATGGGTGAGCCACATCCGGCTGGTACCCGCTTGGTCAATGC
GCAAAAGTGTCTGCGCACCGGTGACATCGATGCGGTGGGCGATAACTCGC
ATCTGACCTTTTTCGAGATGTTGGGTAACTGGTCGTTGGGCGATTACTTC
AAGGAGGAGGCAATCGCGTTCAGCTTTGAATTTCTTACTGGTGCTCCATG
GCTCGGCATATCCCCTGACCGGCTTTCGGTGACTGTTTTTGCAGGGGATG
AGGCTGTTGCGCGTGATGAGGAATCTGCCGCTATCTGGGAACGACTTGGT
ATCGCGCGCACCCATATTCATTTTTTACCACGTGCGGATAACTGGTGGGG
ACCTACGGGGGAAACAGGGCCATGTGGTCCGGATACCGAGATATTCTTTG
ATACTGGAGTTCCTCCTTGCAGTGTGAGCTGTCGTCCGGGATGTTCTTGC
GGCAAGTACGTAGAGATTTGGAATGACGTGTTCATGCAGTATCGTAAGGA
CGCAGACGGCAGGTACCGGCCGCTTGAACGTTATTGTGTGGACACCGGTA
TGGGTATTGAACGCACCGTCGCGGTTTTGCAGGGCAAGCGGTCAGTGTAT
GATACGGAGATCTTTACCCCGCTCCTGGAGCGGATAGGTCAGTTATGTGG
GAAGAGGTATGGGTGTCAGGGAGCGCACGACGTATCCATGCGGATTGTAT
GCGATCATATCCGTGCGGCCACTTTTATCCTCGGCGATCCTGTCCCTGTA
CGCCCATCTAACGTGGGTGCAGGCTACGTACTGCGCAGAATCATTCGCCG
TTCAGTCCGCCACGGAAGGAAGCTCGGTATCGATGGGGAGTTCCTGTCCT
CCCTCGCGCGCGTGGTGATTGGGCAATACGCTGCGGTATACCCGGAACTG
GAAGAGAAAGCTACGTGTATTGCGCAGGAGCTTGCAAACGAGGAACGTAA
GTTCCTCGACGCCCTCAGGAAGGGTGAGGCAGAGTACGAGAGGATGATAC
CCAAGTTTTTACAGGGGACAGAGCGAGAAATACCTGGGTCAGTTGCCTTT
CGGCTATACGATACGTATGGATTCCCCCTTGAGCTGACCGAGGAACTTGC
GCGTGAATCGGGTTTACGGGTGGACCGTGCAGGGTTTGACACCGCGTTTC
AGGCGCACCAGGCGTGCTCTCGGATCGGTGCACAGCGAGTATTTAAGGGT
GGGTTGGCTGATCATTCAGCGGAAACGACAGCGTACCACACGGCGACGCA
TCTGCTGCACCAGGCATTGCGAGTGGTTCTTGGTACGCACGTGCAGCAAA
AAGGCTCAAATATTACGGCAGAACGCCTGCGTTTCGACTTTTCTCACCCA
AGACCGATGAGTGCGCAGGAGAAGGTGCAGGTGGAACAGTTGGTGAATGA
GCAGATCCGGGCAGACTTGCCGGTGTGCTGTGAAGTGATGTCGCTCGAAG
ATGCGATGAATTCTGGTGCCGTGGCGTTGTTTGGTGAGAAATACGAATCA
ACTGTAAAGGTGTACTCCATAGGAACTTTTTCTCGGGAAGTGTGTGGCGG
TCCACATGTAGCACGTACCGGGCAGCTCGGGCGGTTTTCTATTCAAAAGG
AACAGTCGAGTGCGGCGGGGGTGCGGCGTATTCGCGCGATTCTTGAGAAA
AGCGGGGAAAAGTCG


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy