Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Treponema pallidum Search Results

Record: 1 of 1  
MiniMap IGR747 IGR745 IGR748 IGR743 IGR744 IGR742 IGR746 ndk, - TP1010 pth, - TP1011 sigA,rpoD, - TP1012 gpsA, - TP1009 tpn39b,bmp, - TP1016 alaS, - TP1017 TP1014 nrdA, - TP1008 groES, - TP1013 ndk, - TP1010 pth, - TP1011 sigA,rpoD, - TP1012 gpsA, - TP1009 tpn39b,bmp, - TP1016 alaS, - TP1017 TP1014 nrdA, - TP1008 groES, - TP1013 ndk, - TP1010 pth, - TP1011 sigA,rpoD, - TP1012 gpsA, - TP1009 tpn39b,bmp, - TP1016 alaS, - TP1017 TP1014 nrdA, - TP1008 nusB, - TP1015 nusB, - TP1015 groES, - TP1013
* Calculated from Protein Sequence

Gene ID: TP1013

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
groES  

Definition:
chaperonin (heat shock protein GroES)

Gene Start:
1104180

Gene Stop:
1104443

Gene Length:
264

Molecular Weight*:
9424

pI*:
6.53

Net Charge*:
-0.53

EC:
 

Functional Class:
Cellular processes; Chaperones  

Pathway: pathway table

Secondary Evidence:
Houry WA.
Mechanism of substrate recognition by the chaperonin GroEL.
Biochem Cell Biol. 2001;79(5):569-77.
PMID: 11716298

Song JL, Wynn RM, Chuang DT.
Interactions of GroEL/GroES with a heterodimeric intermediate during alpha 2beta 2 assembly of mitochondrial branched-chain alpha-ketoacid dehydrogenase. cis capping of the native-like 86-kDa intermediate by GroES.
J Biol Chem. 2000 Jul;275(29):22305-12.
PMID: 10764784

Chuang JL, Wynn RM, Song JL, Chuang DT.
GroEL/GroES-dependent reconstitution of alpha2 beta2 tetramers of humanmitochondrial branched chain alpha-ketoacid decarboxylase. Obligatory interaction of chaperonins with an alpha beta dimeric intermediate.
J Biol Chem. 1999 Apr;274(15):10395-404.
PMID: 10187829

Chua-Intra B, Peerapakorn S, Davey N, Jurcevic S, Busson M, Vordermeier HM, Pirayavaraporn C, Ivanyi J.
T-cell recognition of mycobacterial GroES peptides in Thai leprosy patients and contacts.
Infect Immun. 1998 Oct;66(10):4903-9.
PMID: 9746595

Comment:
In Bacillus stearothermophilus, this protein binds to Cpn60 in the
presence of Mg-ATP and suppress the ATPase activity of the latter.
It is induced by heat shock.

Blast Summary:  PSI-Blast Search
Gapped BLAST revealed several significant hits to chaperonin GroES
proteins. For example residues 5-87 are 51% similar to CH10_BACST,
chaperonin GroES protein of Bacillus stearothermophilus,(L10132).

COGS Summary:  COGS Search
BeTs to 13 clades of COG0234
COG name: Co-chaperonin GroES (HSP10)
Functional Class:? O
The phylogenetic pattern of COG0234 is ----yqvcebrhujgpolinx
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search
Residues 30-82, 3-55, 37-88, 23-75, and 29-81 represent significant
(98%) hits to block BL00681, Chaperonins cpn10 proteins.

ProDom Summary:  Protein Domain Search
Residues 24-78 are 54% similar to chaperonin of CH10_THEBR.

Paralogs:  Local Blast Search
There is no evidence of paralogs in T. pallidum.

Pfam Summary:  Pfam Search
Residues 2 to 88 (E-value = 4.3e-34) place TP1013 in the Cpn10 family which is described as Chaperonin 10 Kd subunit (PF00166)

PDB Hit:
gi|1942632|pdb|1LEP|A Mycobacterium leprae

Gene Protein Sequence:
MKIIPLADRVLVKTDKSETKTASGIIIPDTAQEKMQSGTVIAVGSDSEKI
KVSVGQRVMHDKYAGNPVKIDGEEHLLLKGADILAVIE

Gene Nucleotide Sequence:  Sequence Viewer
ATGAAAATTATACCGCTCGCGGACCGTGTCCTGGTAAAAACTGATAAATC
GGAAACTAAGACTGCTTCTGGAATCATCATCCCGGACACTGCGCAGGAGA
AGATGCAAAGCGGTACCGTCATTGCTGTTGGTTCTGACTCGGAAAAGATA
AAAGTTTCGGTGGGTCAGCGTGTCATGCACGATAAATATGCCGGAAACCC
AGTAAAGATTGATGGAGAGGAGCACCTGCTGCTCAAGGGTGCTGATATCC
TAGCTGTCATCGAG


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy