Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Treponema pallidum Search Results

Record: 1 of 1  
MiniMap IGR747 IGR745 IGR741 IGR743 IGR744 IGR742 IGR746 ndk, - TP1010 pth, - TP1011 thy1, - TP1007 sigA,rpoD, - TP1012 gpsA, - TP1009 tpn39b,bmp, - TP1016 TP1014 nrdA, - TP1008 groES, - TP1013 ndk, - TP1010 pth, - TP1011 thy1, - TP1007 sigA,rpoD, - TP1012 gpsA, - TP1009 tpn39b,bmp, - TP1016 TP1014 nrdA, - TP1008 groES, - TP1013 ndk, - TP1010 pth, - TP1011 thy1, - TP1007 sigA,rpoD, - TP1012 gpsA, - TP1009 tpn39b,bmp, - TP1016 TP1014 nrdA, - TP1008 nusB, - TP1015 nusB, - TP1015 groES, - TP1013
* Calculated from Protein Sequence

Gene ID: TP1011

DNA Molecule Name:
1  

Genbank ID:
3323339

Gene Name:
pth  

Definition:
peptidyl-tRNA hydrolase

Gene Start:
1103005

Gene Stop:
1102400

Gene Length:
606

Molecular Weight*:
22162

pI*:
8.34

Net Charge*:
3.48

EC:
3.1.1.29  

Functional Class:
Translation; tRNA modification  

Pathway: pathway table
Miscellaneous Enzymes

Comment:
The natural substrate for this enzyme may be peptidyl-tRNAs which
drop off the ribosome during protein synthesis.

Reaction:
N-SUBSTITUTED AMINOACYL-TRNA + H(2)O = N-SUBSTITUTED AMINO ACID + TRNA.

Blast Summary:  PSI-Blast Search
Gapped BLAST revealed several significant hits to peptidyl-tRNA
hydrolase proteins. For example residues 5-192 are 34% similar to
PTH_MYCTU, peptidyl-tRNA hydrolase of Mycobacterium tuberculosis,
(Z92539).

COGS Summary:  COGS Search
BeTs to 13 clades of COG0193
COG name: Peptidyl-tRNA hydrolase
Functional Class:  J
The phylogenetic pattern of COG0193 is ----yqvcebrhujgpolinx
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search
Residues 5-30, 62-73, 90-128, 89-127, and 132-140 represent significant
(100%) hits to blocks BL01195A,B,C,D, Peptidyl-tRNA hydrolase proteins.

ProDom Summary:  Protein Domain Search
Residues 5-138 are 42% similar to peptidyl-tRNA hydrolase of PTH_MYCTU.
Residues 9-160 also support this match.

Paralogs:  Local Blast Search
There is no evidence of paralogs in T. pallidum.

Pfam Summary:  Pfam Search
Residues 5 to 190 (E-value = 2.8e-50) place TP1011 in the Pept_tRNA_hydro family which is described as Peptidyl-tRNA hydrolase (PF01195)

PDB Hit:
none

Gene Protein Sequence:
MGIQLIVFLGNPGAEYEETRHNAAWLLLTYLFPSIVLPWRCGCRGSIARI
EGFEGSSEEVWLLKPLTYMNRSGKSVGAACAFLQTDAKQLLVVHDELELP
FGVVSLKQGGGLGGHNGLRSIKEVLGTADFWRLRIGIGRPPSESVNIAQY
VLSAFYPAEMAAFPKLGRATRDLLCQLVVTDQAATVTLLSAWRKKRLLSL
CE

Gene Nucleotide Sequence:  Sequence Viewer
TTGGGCATACAACTTATAGTGTTTTTAGGAAATCCTGGTGCAGAGTACGA
AGAAACGCGGCACAATGCTGCATGGTTGCTTTTAACGTACCTTTTCCCAT
CCATCGTGCTTCCTTGGCGATGCGGATGTCGGGGGTCGATTGCGCGTATT
GAAGGGTTTGAAGGGTCAAGCGAAGAAGTTTGGCTTTTGAAACCGCTGAC
TTATATGAACCGTTCTGGGAAAAGCGTAGGGGCAGCATGTGCCTTTTTGC
AGACGGATGCGAAGCAGCTCTTAGTAGTGCACGATGAATTAGAATTACCG
TTCGGTGTGGTGAGTTTAAAACAAGGCGGAGGGCTTGGAGGACACAATGG
GTTGCGCTCTATCAAGGAAGTGCTTGGTACCGCAGATTTTTGGCGGTTGC
GCATAGGCATCGGGCGTCCACCCAGTGAGAGTGTGAATATAGCGCAGTAC
GTCCTCTCTGCCTTTTACCCGGCAGAGATGGCTGCATTCCCAAAGCTGGG
GCGTGCCACGCGAGATCTTCTGTGTCAGCTTGTAGTAACAGATCAGGCAG
CGACAGTCACCTTACTCAGTGCGTGGAGAAAAAAACGGTTGCTGTCTTTA
TGCGAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy