Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Treponema pallidum Search Results

Record: 1 of 1  
MiniMap IGR747 IGR745 IGR741 IGR743 IGR740 IGR744 IGR742 IGR746 ndk, - TP1010 pth, - TP1011 thy1, - TP1007 sigA,rpoD, - TP1012 gpsA, - TP1009 gyrB, - TP1006 TP1014 nrdA, - TP1008 groES, - TP1013 ndk, - TP1010 pth, - TP1011 thy1, - TP1007 sigA,rpoD, - TP1012 gpsA, - TP1009 gyrB, - TP1006 TP1014 nrdA, - TP1008 groES, - TP1013 ndk, - TP1010 pth, - TP1011 thy1, - TP1007 sigA,rpoD, - TP1012 gpsA, - TP1009 gyrB, - TP1006 TP1014 nrdA, - TP1008 groES, - TP1013
* Calculated from Protein Sequence

Gene ID: TP1009

DNA Molecule Name:
1  

Genbank ID:
3323337

Gene Name:
gpsA  

Definition:
glycerol-3-phosphate dehydrogenase (NAD(P)H-dependent dihydroxyacetone-phosphate reductase)

Gene Start:
1101725

Gene Stop:
1100658

Gene Length:
1068

Molecular Weight*:
37866

pI*:
6.90

Net Charge*:
-0.45

EC:
1.1.1.94  

Functional Class:
Fatty acid and phospholipid metabolism  

Pathway: pathway table
Metabolism of complex lipids; Glycerolipid metabolism

Comment:
Reaction:
SN-GLYCEROL 3-PHOSPHATE + NAD(P)(+) = GLYCERONE PHOSPHATE + NAD(P)H.

Blast Summary:  PSI-Blast Search
Gapped BLAST revealed several significant hits to glycerol-3-phosphate
dehydrogenase proteins. For example residues 20-354 are 32% similar
to GPDA_BACSU, glycerol-3-phosphate dehydrogenase (NAD(P)H-dependent
dihydroxyacetone-phosphate reductase) of Bacillus subtilis,(U32164).

COGS Summary:  COGS Search
BeTs to 14 clades of COG0240
COG name: Glycerol 3-phosphate dehydrogenase
Functional Class:  C
The phylogenetic pattern of COG0240 is a-t-YqvcebRhuj--olinx
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search
Residues 4-23, 35-80, 195-240, 200-245, 256-277, and 258-279 represent
significant (100%) hits to blocks BL00957A,C,E,F, NAD-dependent
glycerol-3-phosphate dehydrogenase proteins. Residues 3-25 and 124-139
represent significant (98%) hits to blocks PR00420A,C, AROMATIC-RING
HYDROXYLASE (FLAVOPROTEIN MONOOXYGENASE) SIGNATURE. Residues 3-25 and
4-18 represent significant (97%) hits to blocks PR00419A,D, ADRENODOXIN
REDUCTASE FAMILY SIGNATURE.

ProDom Summary:  Protein Domain Search
Residues 40-313 are 34% similar to glycerol-3-phosphate dehydrogenase
of GPDA_BACSU. Residues 4-33 also support this match.

Paralogs:  Local Blast Search
There is no evidence of paralogs in T. pallidum.

Pfam Summary:  Pfam Search
Residues 3 to 353 (E-value = 2.2e-163) place TP1009 in the NAD_Gly3P_dh family which is described as NAD-dependent glycerol-3-phosphate dehydrogenase (PF01210)

Structural Feature(s):
Feature Type  Start  Stop
transmembrane  
57  
90
transmembrane  
198  
217

PDB Hit:
none

Gene Protein Sequence:
MASIAILGGGAWGTALAASLTVNGHTVMLWARRRQTCDAINARNENVQYL
PGITLPAALCASPDMAYVCAGADLIVLAVPSCYLAEVAALMNTTPRFQRL
RTAAVGQEYPLIGILTKGFIPDQEGMPHLITDALGALLPSGAHGQLVYIS
GPSHAQEVAQGKVTGLIAASQNPMAAIRVRELLRSKRVQVYSSLDVVGVQ
VCAAVKNVIAIAFGLLDAMAEHSEAFGDNTESMLLAAGLNEIQTIGKQLG
STHPETFTSLAGIGDLDVTCRSAYGRNRRFGRDIVHKGILDSFSGIQDLV
SRLPEVGYLAEGVVACMHVQRLAERDRLKVPICAGLYAILNREKGADTFM
QEILGW

Gene Nucleotide Sequence:  Sequence Viewer
ATGGCTTCGATTGCAATACTCGGTGGAGGGGCATGGGGCACGGCGCTTGC
TGCGTCTCTCACCGTAAACGGTCACACCGTAATGCTGTGGGCCCGTCGTA
GGCAGACGTGCGATGCTATCAATGCACGAAACGAAAATGTTCAGTATCTG
CCGGGCATTACGTTGCCCGCAGCCTTGTGTGCCTCTCCCGATATGGCATA
TGTCTGTGCCGGCGCGGATCTTATTGTATTAGCGGTTCCTTCGTGCTATT
TGGCTGAAGTAGCTGCGCTTATGAATACCACTCCTCGTTTTCAGAGGTTG
CGTACTGCTGCCGTAGGACAGGAATATCCCCTTATTGGTATTTTGACAAA
AGGATTTATTCCGGATCAGGAAGGGATGCCTCATCTAATTACCGATGCGC
TGGGTGCGTTGTTGCCGTCTGGGGCGCACGGGCAGCTCGTGTATATTTCG
GGTCCAAGCCATGCACAGGAGGTAGCGCAGGGAAAGGTGACCGGACTTAT
TGCAGCGAGCCAAAATCCTATGGCGGCCATTCGGGTGCGGGAATTGCTGC
GCTCGAAGAGGGTGCAGGTGTATTCCAGTCTTGATGTTGTTGGGGTGCAA
GTGTGTGCAGCGGTAAAAAACGTGATTGCCATTGCATTTGGTCTTTTGGA
TGCGATGGCTGAGCATTCTGAAGCTTTTGGGGACAATACAGAGTCGATGC
TGCTCGCAGCGGGCTTGAATGAAATTCAAACCATTGGAAAACAGTTGGGT
TCTACACATCCTGAAACATTCACATCGCTTGCAGGAATAGGAGATTTGGA
TGTGACGTGTCGCAGCGCGTATGGACGCAACCGACGTTTCGGACGCGACA
TAGTGCATAAGGGGATCCTTGATTCCTTTTCTGGAATACAGGATCTCGTG
AGTCGTTTGCCCGAAGTAGGGTATCTGGCGGAAGGGGTAGTTGCCTGTAT
GCATGTGCAGCGCCTGGCTGAGCGGGATCGGTTGAAGGTTCCAATTTGCG
CGGGACTGTACGCTATTTTAAATCGGGAAAAGGGTGCTGACACCTTTATG
CAAGAGATTCTTGGTTGG


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy