Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Treponema pallidum Search Results

Record: 1 of 1  
MiniMap IGR745 IGR741 IGR739 IGR743 IGR740 IGR744 IGR742 IGR746 ndk, - TP1010 pth, - TP1011 thy1, - TP1007 sigA,rpoD, - TP1012 gpsA, - TP1009 dnaX, - TP1005 gyrB, - TP1006 nrdA, - TP1008 groES, - TP1013 ndk, - TP1010 pth, - TP1011 thy1, - TP1007 sigA,rpoD, - TP1012 gpsA, - TP1009 dnaX, - TP1005 gyrB, - TP1006 nrdA, - TP1008 groES, - TP1013 ndk, - TP1010 pth, - TP1011 thy1, - TP1007 sigA,rpoD, - TP1012 gpsA, - TP1009 dnaX, - TP1005 gyrB, - TP1006 nrdA, - TP1008 groES, - TP1013
* Calculated from Protein Sequence

Gene ID: TP1008

DNA Molecule Name:
1  

Genbank ID:
3323332

Gene Name:
nrdA  

Definition:
ribonucleoside-diphosphate reductase alpha chain (Ribonucleotide reductase alpha chain)

Gene Start:
1100528

Gene Stop:
1097994

Gene Length:
2535

Molecular Weight*:
95982

pI*:
7.57

Net Charge*:
4.94

EC:
1.17.4.1  

Functional Class:
Purines, pyrimidines, nucleosides, and nucleotides; 2'-Deoxyribonucleotide metabolism  

Pathway: pathway table
Nucleotide metabolism; Purine Metabolism
Nucleotide metabolism; Pyrimidine Metabolism

Comment:
This protein catalyzes the biosynthesis of deoxyribonucleotides from
the corresponding ribonucleotides, precursors that are necessary for
DNA synthesis.

Reaction:
2'-DEOXYRIBONUCLEOSIDE DIPHOSPHATE + OXIDIZED THIOREDOXIN + H(2)O =
RIBONUCLEOSIDE DIPHOSPHATE + REDUCED THIOREDOXIN.

There may be an extra N-terminal region in the protein.

Blast Summary:  PSI-Blast Search
Gapped BLAST revealed several significant hits to ribonucleotide
reductase alpha chain proteins. Residues 139-838 are 37% similar
to RIR1_HELPY, ribonucleoside-diphosphate reductase 1 alpha subunit
of Helicobacter pylori,(AE000581).

COGS Summary:  COGS Search
BeTs to 15 clades of COG0209
COG name: Ribonucleotide reductase alpha subunit
Functional Class:  F
The phylogenetic pattern of COG0209 is a-tKYqvcEBRhujgp-linx
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search
Residues 228-251, 303-321, 346-390, 392-423, 510-545, 570-579,
702-741, and 817-836 represent significant (100%) hits to blocks
BL00089A,B,C,D,F,G,H,I, Ribonucleotide reductase large subunit
proteins.

ProDom Summary:  Protein Domain Search
Residues 369-734 are 41% similar to ribonucleotide reductase/ ribonucleoside-
diphosphate reductase of RIR1_HELPY. Residues 261-368, 749-831, and
771-834 also support this match.

Paralogs:  Local Blast Search
There is no evidence of paralogs in T. pallidum.

Pfam Summary:  Pfam Search
Residues 1 to 98 (E-value = 6.7e-27) place TP1008 in the ATP-cone family which is described as ATP cone domain (PF03477)
Residues 237 to 314 (E-value = 1e-27) place TP1008 in the Ribonuc_red_lgN family which is described as Ribonucleotide reductase, all-alpha domain (PF00317)
Residues 316 to 834 (E-value = 1.2e-124) place TP1008 in the Ribonuc_red_lgC family which is described as Ribonucleotide reductase, barrel domain (PF02867)

PDB Hit:
gi|2914234|pdb|4R1R|A Chain A, Ribonucleotide Reductase R1 Protein With Substrate, Gdp And Effector Dttp From Escherichia Coli Ribonucleotide Reductase, Deoxyribonucleotide Synthesis, Radical Chemistry, Allosteric Regulation, Specificity, Complex (Oxidore

Gene Protein Sequence:
MHIIKRNGEPQPYMREKIIVAISAAFRSVQNPLAPEVPAIITDLAAEVER
QLFEMNRAGVPVHVEKIQDFVEKTLTKYNHSDEVKSFILYRDDRTKKRIA
REQIACCFTDSSVLGVLKEIQQDFPFPEYSLDALASKFLLFKKEVTDERR
SMQLLIKAAVELTAQEAPQWELIAARLLMLDFSLALGTSLEKLNIHSFYE
KITYLEEAGLYGVYIRTHYSRAEIEEAATYLECSRDKLFTYSSLDMILRR
YVIRTRAHVPLETPQEMFLGIALHLAMNETQDRMQWVKRFYTVLSKLQVT
VATPTLSNARKPFHQLSSCFVDTVPDSLDGIYRSIDNFSQVSKFGGGMGL
YFGKVRAVGAPIRGFQGAAGGILRWIKLANDTAVAVDQLGVRQGSVAVYL
DVWHKDIPEFLQLRTNNGDDRMKAHDVFPAVCYPDLFWKTVRDNLGASWY
LMCPHEILTVKGYALEDFYAEEWEKRYWDCVKDARISKRTIPIKELVRLV
LKSVVETGTPFAFYRDHANRANPNGHRGIIYCSNLCTEIAQNMSAINLVS
VKITEVDGQKVVVQTTRPGDFVVCNLASLVLSNIDLSDDKELREVVRVAV
RALDNVIDLTYYPVPYAQVTNAYYRAIGLGVSGYHHVLAQQGIDWESDEH
LAFADRIFERINRAAIEASMTIAREKGAYGCFTGSDWCTGAYFRKRGYVS
EDWQRLQREVATHGMRNGYLLAVAPTSSTSIIAGTTAGVDPIMKQYFLEE
KKGMLMPRVAPSLSQKTCPLYKSAHAVEQRWSIRAAGLRQRHIDQAQSVN
LYITTDFTLKQVLDLYVYAWEVGMKSLYYVRSQSLEIDLCGYCAS

Gene Nucleotide Sequence:  Sequence Viewer
ATGCATATCATCAAGCGAAATGGCGAACCGCAACCTTACATGCGCGAGAA
AATAATTGTTGCTATCAGTGCTGCTTTTAGAAGTGTCCAGAATCCTCTTG
CTCCTGAAGTTCCTGCTATCATCACAGATCTTGCCGCGGAGGTTGAGCGA
CAGCTTTTTGAGATGAACCGTGCGGGCGTTCCTGTTCACGTGGAAAAGAT
TCAGGACTTTGTCGAAAAGACTCTTACCAAATACAATCACAGCGATGAAG
TGAAGAGTTTTATCCTGTACCGTGACGATCGCACAAAAAAGCGTATTGCA
AGAGAACAGATTGCGTGCTGTTTTACTGACTCTTCAGTGCTCGGTGTACT
GAAAGAAATCCAACAAGACTTTCCGTTTCCTGAGTACAGTCTCGATGCAC
TCGCCAGTAAGTTCCTGCTCTTTAAAAAAGAAGTTACGGACGAGCGTCGG
AGTATGCAACTGCTTATTAAGGCAGCGGTGGAACTGACTGCCCAAGAGGC
TCCCCAGTGGGAGCTTATTGCTGCGCGCTTGCTTATGCTCGACTTTTCAC
TCGCGCTAGGAACATCTTTGGAAAAGTTAAATATTCACTCCTTCTACGAG
AAAATAACTTATCTTGAAGAGGCCGGTCTATATGGGGTGTACATCCGCAC
GCACTATAGTCGGGCAGAAATTGAGGAAGCTGCCACGTATCTTGAGTGTA
GTCGCGATAAATTGTTTACGTACAGCAGTCTGGATATGATTCTGCGTCGC
TATGTGATCAGAACGCGTGCGCATGTACCTCTTGAAACTCCTCAGGAGAT
GTTTCTCGGTATTGCACTGCATCTAGCGATGAATGAAACCCAAGATCGTA
TGCAATGGGTAAAACGCTTTTATACAGTCCTCAGCAAGTTGCAGGTTACG
GTCGCAACACCTACGCTTTCAAACGCGCGCAAACCTTTTCATCAACTTTC
CTCGTGTTTCGTTGATACGGTGCCAGATTCGCTCGACGGTATCTACCGCA
GCATCGACAATTTTTCCCAGGTATCTAAGTTTGGGGGAGGGATGGGGCTG
TACTTTGGAAAAGTGCGTGCGGTAGGCGCTCCCATTCGGGGGTTCCAGGG
TGCTGCAGGTGGTATTCTCCGTTGGATTAAGCTCGCCAATGATACTGCAG
TTGCAGTAGATCAACTAGGAGTACGCCAAGGCTCGGTGGCAGTGTATTTG
GATGTATGGCACAAGGATATTCCGGAATTTTTGCAATTACGGACTAATAA
TGGGGATGACCGCATGAAAGCACATGACGTATTTCCTGCGGTCTGTTATC
CAGATTTGTTCTGGAAGACAGTACGCGATAATTTGGGGGCGTCGTGGTAT
TTAATGTGTCCGCATGAGATTCTTACGGTGAAAGGCTATGCTTTGGAGGA
TTTTTATGCGGAGGAATGGGAGAAGCGCTACTGGGATTGTGTAAAGGATG
CGCGTATCTCTAAGAGGACCATTCCGATTAAGGAGTTGGTGCGCTTGGTG
CTAAAATCTGTGGTGGAAACCGGTACTCCCTTTGCGTTTTACCGAGATCA
TGCAAACCGTGCAAATCCCAATGGGCATCGGGGAATTATTTACTGTTCTA
ATTTGTGTACTGAAATTGCGCAGAACATGAGCGCTATTAATTTAGTAAGC
GTAAAAATCACCGAGGTTGATGGACAAAAGGTAGTGGTGCAGACAACGCG
GCCGGGGGATTTTGTTGTATGTAACCTCGCGTCGTTGGTGCTGAGCAATA
TTGACCTTTCAGATGATAAGGAGTTGCGCGAGGTAGTGCGTGTGGCGGTA
CGTGCATTAGACAACGTGATCGATTTGACATATTATCCGGTTCCCTATGC
ACAGGTAACCAATGCGTATTATCGTGCTATTGGTTTAGGTGTTTCAGGCT
ACCATCACGTGCTTGCCCAGCAAGGAATCGATTGGGAAAGTGATGAACAT
CTTGCATTTGCGGACAGAATATTTGAGCGCATTAACCGTGCCGCAATTGA
AGCGAGTATGACAATCGCGCGCGAGAAGGGTGCGTATGGGTGTTTCACTG
GGAGCGATTGGTGTACCGGTGCGTATTTTCGCAAACGCGGCTATGTCTCT
GAAGACTGGCAACGTTTGCAGCGTGAGGTAGCAACACATGGGATGCGCAA
CGGTTACTTACTTGCAGTCGCGCCAACTAGTTCTACGTCTATCATTGCAG
GGACCACTGCGGGTGTAGATCCTATTATGAAGCAGTATTTCCTCGAGGAA
AAGAAAGGCATGCTAATGCCACGCGTAGCTCCTTCTCTTTCGCAGAAGAC
CTGTCCACTGTATAAAAGTGCACACGCAGTGGAGCAGCGTTGGAGTATCC
GTGCTGCGGGTCTGCGGCAACGACATATTGACCAGGCACAGTCAGTGAAT
CTGTACATTACAACGGACTTTACACTGAAGCAGGTTCTAGATTTGTACGT
GTATGCGTGGGAAGTAGGAATGAAGTCACTATACTACGTACGAAGCCAGT
CGCTCGAAATAGATTTGTGTGGGTATTGTGCCTCG


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy