Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Treponema pallidum Search Results

Record: 1 of 1  
MiniMap IGR737 IGR741 IGR739 IGR738 IGR743 IGR740 IGR744 IGR742 ndk, - TP1010 recR, - TP1004 pth, - TP1011 thy1, - TP1007 gpsA, - TP1009 dnaX, - TP1005 gyrB, - TP1006 nrdA, - TP1008 TP1003 ndk, - TP1010 recR, - TP1004 pth, - TP1011 thy1, - TP1007 gpsA, - TP1009 dnaX, - TP1005 gyrB, - TP1006 nrdA, - TP1008 TP1003 Type: tandem, Name:  - 222 recR, - TP1004 pth, - TP1011 thy1, - TP1007 gpsA, - TP1009 dnaX, - TP1005 gyrB, - TP1006 nrdA, - TP1008 ndk, - TP1010 TP1003
* Calculated from Protein Sequence

Gene ID: TP1007

DNA Molecule Name:
1  

Genbank ID:
3323331

Gene Name:
thy1  

Definition:
thymidylate synthase-complementing protein

Gene Start:
1097948

Gene Stop:
1097034

Gene Length:
915

Molecular Weight*:
34172

pI*:
8.24

Net Charge*:
4.90

EC:
2.1.1.45  

Functional Class:
Unknown  

Pathway: pathway table
Miscellaneous Enzymes

Comment:
In Dictyostelium discoideum, this protein is able to complement
thymidine growth requirement of the mutant HPS400, but shows no
homology to thymidylate synthase.

Blast Summary:  PSI-Blast Search
Gapped BLAST revealed significant hits to some thymidylate synthase-
complementing proteins. Residues 40-272 are 47% similar to thymidylate
synthase-complementing protein of Borrelia burgdorferi,(AE000790).

COGS Summary:  COGS Search
BeTs to 9 clades of COG1351
COG name: Uncharacterized ACR, THY1 family
Functional Class:  S
The phylogenetic pattern of COG1351 is ---k-qvc--r-uj--olinx
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search
Residues 9-25 represent a significant (95%) hit to block PR00550A,
HYPERGLYCEMIC HORMONE SIGNATURE.

ProDom Summary:  Protein Domain Search
Residues 46-254 are 47% similar to thymidylate synthase-complementing
protein of THY1_DICDI. Residues 77-252 are 25% similar to YDAP_BRELA,
a hypothetical protein.

Paralogs:  Local Blast Search
There is no evidence of paralogs in T. pallidum.

Pfam Summary:  Pfam Search
Residues 47 to 257 (E-value = 2.8e-117) place TP1007 in the Thy1 family which is described as Thymidylate synthase complementing protein (PF02511)

Structural Feature(s):
Feature Type  Start  Stop
non-globular  
268  
305

PDB Hit:
none

Gene Protein Sequence:
MTLRTLQAGVAVSIALDRVCFFCYNGAVAHCVVEAAEDILDRRFSVLDKG
FVRLIDYLGGDARIVQAARVSYGAGTRTARDDAALIDFLLRNKHTSPFEQ
VVLTFHVRAPIFVARQWMRHRTARISEVSSRYSLLSHDCYVPQETSVAVQ
STRNKQGRASEGISPEQQQEVRAAFEAQQKAACAAYDALIQKNIARELAR
INVPLSLYTEWYWQIDLHNLFHFLRLRASAHAQAEIRAYAEVIIEITRAV
APCATASFENHEKDGVQFSGREFAALKALLAGEGLSLEGKERARFEEKLR
SGLQQ

Gene Nucleotide Sequence:  Sequence Viewer
GTGACGTTGCGTACGCTTCAAGCCGGTGTGGCGGTCAGTATCGCTCTGGA
TCGTGTGTGCTTTTTCTGTTATAACGGGGCGGTGGCACACTGTGTAGTAG
AAGCTGCCGAAGATATTTTGGACCGGCGTTTTTCTGTATTGGATAAGGGT
TTCGTGCGTTTGATAGATTACCTGGGAGGGGATGCACGCATTGTGCAGGC
AGCGCGTGTTTCTTACGGTGCGGGGACTAGGACTGCGCGTGACGATGCGG
CGCTTATCGATTTTCTTTTACGCAATAAGCATACGTCTCCTTTTGAGCAG
GTGGTCCTTACCTTCCATGTACGTGCACCGATTTTTGTCGCGCGTCAGTG
GATGCGGCATCGCACTGCTCGCATCAGTGAGGTGTCTAGTCGTTATTCGC
TTCTTAGTCATGACTGTTATGTTCCGCAGGAAACTTCAGTTGCAGTTCAG
TCCACGCGTAACAAGCAGGGCCGCGCGTCCGAAGGTATCTCTCCTGAACA
GCAGCAGGAAGTGCGGGCAGCGTTTGAAGCTCAGCAGAAAGCGGCGTGTG
CCGCTTACGACGCATTGATTCAAAAGAACATCGCGCGGGAGCTAGCGCGT
ATTAACGTGCCGCTTTCGCTTTACACCGAGTGGTATTGGCAGATTGATTT
ACACAATCTTTTTCATTTTTTGCGTTTACGTGCGAGCGCTCATGCGCAAG
CAGAGATTCGTGCGTATGCAGAGGTAATCATTGAAATTACCCGTGCAGTT
GCGCCGTGCGCTACCGCCTCTTTTGAAAATCATGAAAAAGATGGGGTGCA
GTTTTCAGGGCGGGAGTTTGCTGCGCTTAAGGCCTTACTGGCTGGAGAGG
GTCTCTCCCTTGAGGGGAAGGAACGTGCGCGCTTTGAAGAAAAATTACGC
TCTGGCCTGCAGCAG


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy