Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Treponema pallidum Search Results

Record: 1 of 1  
MiniMap IGR737 IGR741 IGR739 IGR738 IGR740 IGR742 IGR736 recR, - TP1004 TP1002 thy1, - TP1007 gpsA, - TP1009 dnaX, - TP1005 gyrB, - TP1006 nrdA, - TP1008 TP1003 recR, - TP1004 TP1002 thy1, - TP1007 gpsA, - TP1009 dnaX, - TP1005 gyrB, - TP1006 nrdA, - TP1008 TP1003 Type: tandem, Name:  - 222 recR, - TP1004 TP1002 thy1, - TP1007 gpsA, - TP1009 dnaX, - TP1005 gyrB, - TP1006 nrdA, - TP1008 TP1003
* Calculated from Protein Sequence

Gene ID: TP1006

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
gyrB  

Definition:
DNA gyrase subunit B (DNA topoisomerase II)

Gene Start:
1096922

Gene Stop:
1095012

Gene Length:
1911

Molecular Weight*:
70902

pI*:
7.92

Net Charge*:
3.78

EC:
5.99.1.3  

Functional Class:
Replication; DNA replication, restriction, modification, recombination, and repair  

Pathway: pathway table
Miscellaneous Enzymes

Primary Evidence:
Stamm LV, Greene SR, Barnes NY. 1997. Identification and characterization of the gyrB gene from Treponema pallidum subsp. pallidum. FEMS Microbiol Lett 153(1):129-34 (1997).
Medline: 97396391.

Comment:
DNA gyrase negatively supercoils closed circular double-stranded DNA in an ATP-dependent manner and also catalyzes the interconversion of other topological isomers of double-stranded DNA rings, including catenanes and knotted rings.

Reaction:
ATP-dependent breakage, passage and rejoining of double-stranded DNA.

Blast Summary:  PSI-Blast Search
Gapped BLAST revealed this protein is identical to DNA gyrase subunit
B of Treponema pallidum,(U78094). In addition there are several
other significant hits to DNA gyrase subunit B proteins. For example
5-637 are 52% similar to GYRB_BACSU, DNA gyrase subunit B of Bacillus
subtilis,(Z99104).

COGS Summary:  COGS Search
BeTs to 14 clades of COG0187
COG name: DNA gyrase (topoisomerase II) B subunit
Functional Class:  L
The phylogenetic pattern of COG0187 is a---yqvCEBrHujGPOlINX
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search
Residues 16-30, 68-113, 69-114, 164-175, 269-282, 333-344, 428-471,
491-526, and 571-596 represent significant (100%) hits to blocks
BL00177A,B,C,D,E,F,G,H, DNA topoisomerase II proteins.

ProDom Summary:  Protein Domain Search
Residues 255-484 are 56% similar to DNA gyrase subunit B of GYRB_BACSU.
Residues 5-43, 44-175, 222-254, 493-560, and 601-629 also support
this match.

Paralogs:  Local Blast Search
There is no evidence of paralogs in T. pallidum.

Pfam Summary:  Pfam Search
Residues 30 to 173 (E-value = 1.6e-29) place TP1006 in the HATPase_c family which is described as Histidine kinase-, DNA gyrase B-, and HSP90-like ATPase (PF02518)
Residues 222 to 395 (E-value = 2.3e-89) place TP1006 in the DNA_gyraseB family which is described as DNA gyrase B (PF00204)
Residues 422 to 528 (E-value = 8.2e-07) place TP1006 in the Toprim family which is described as Toprim domain (PF01751)
Residues 561 to 627 (E-value = 6.9e-45) place TP1006 in the DNA_gyraseB_C family which is described as DNA gyrase B subunit, carboxyl terminus (PF00986)

Structural Feature(s):
Feature Type  Start  Stop
non-globular  
65  
147

PDB Hit:
None

Gene Protein Sequence:
MGIEYSASSITVLEGLEAVRKRPGMYIGSTGPNGLHHLVYEVVDNCIDEA
MAGYCDRITVVLEQGNVVRVEDNGRGIPVDVHPHEGVSALEVVLTKLHAG
GKFDKKSYKVSGGLHGVGVSVVNALSLWVEVTVYRDGAEYYQKFNVGMPL
APVEKRGVSEKRGTIIRWQADPSIFKETVAYDFDVLLTRLRELAFLNSTV
VIQLRDERLATAKQVEFAFEGGIRHFVSYLNRGKSVVPERPLYIEGSKSD
VLVEVALQYHDGYTENVQSFVNDINTREGGTHLEGFKSALTRVANDFLKK
SPKLAKKIEREEKLVGEDVRAGLTVVLSVKIPEPQFEGQTKTKLGNSEVR
GIVDSLVGERLTLYFEQNPGVLTKILEKSIAEAQARLAARRAKEAARRKS
GMDSFGLPGKLADCSLKDPAKCEVYIVEGDSAGGSAKKGRDSKTQAILPL
WGKMLNVEKTRLDKVLHNEKLQPIIATLGTGVGKDFDLTRIRYHKVIIMA
DADVDGSHIRTLLLTFFFRYLPQIIEAGYVYLAMPPLYRIAWSKKELYVY
SDTERDEALESIGKKSGVAVQRYKGLGEMDGTQLWETTMNPVRRKMMQVV
LSDAVEADRVFSTLMGEDVEPRRKFIEENAIYARLDV

Gene Nucleotide Sequence:  Sequence Viewer
ATGGGGATTGAGTACTCAGCGAGTAGCATTACTGTATTGGAAGGTCTTGA
AGCGGTACGCAAGCGTCCGGGGATGTATATCGGCTCTACCGGTCCTAATG
GATTGCACCATCTGGTGTACGAGGTGGTGGATAACTGTATCGATGAAGCC
ATGGCTGGGTACTGTGATCGTATCACCGTGGTGCTCGAACAAGGAAACGT
CGTGCGTGTTGAAGACAACGGGCGAGGTATTCCTGTTGACGTGCACCCTC
ATGAGGGGGTTAGTGCGCTTGAGGTTGTACTTACTAAGTTACATGCGGGG
GGGAAGTTTGACAAGAAATCGTATAAGGTGTCGGGTGGACTCCACGGAGT
TGGAGTTTCTGTGGTCAACGCGCTGTCGTTGTGGGTAGAAGTGACAGTGT
ATCGTGATGGTGCTGAGTATTATCAGAAGTTTAATGTGGGGATGCCGCTT
GCTCCAGTAGAGAAGCGGGGAGTGTCGGAAAAACGTGGCACTATTATCCG
CTGGCAGGCGGACCCATCCATTTTCAAAGAAACGGTGGCCTATGATTTTG
ACGTACTCCTGACGCGTTTGCGTGAACTTGCTTTTTTGAATAGCACGGTA
GTTATTCAGTTGCGTGATGAGCGGTTGGCGACCGCTAAACAGGTTGAATT
TGCGTTCGAAGGAGGTATTCGTCATTTTGTCAGTTATTTAAACCGCGGTA
AATCAGTTGTGCCCGAACGTCCTCTGTACATTGAGGGATCGAAGTCGGAT
GTTTTAGTGGAAGTTGCGTTGCAATATCACGATGGTTATACGGAAAACGT
GCAGTCATTTGTCAATGATATTAATACCCGTGAGGGGGGCACGCATCTTG
AAGGATTTAAGTCGGCACTTACGCGTGTGGCGAACGATTTTTTGAAAAAA
AGTCCAAAGCTTGCAAAGAAGATAGAAAGGGAAGAAAAGCTCGTTGGGGA
AGATGTGCGTGCTGGATTGACAGTGGTGCTTTCTGTGAAAATTCCTGAAC
CCCAGTTTGAAGGGCAGACAAAGACGAAGTTGGGAAACAGTGAGGTGCGG
GGTATTGTTGATTCTTTGGTGGGGGAGCGTCTGACGCTCTATTTTGAGCA
AAATCCAGGTGTGCTTACAAAGATTCTTGAAAAGAGCATTGCAGAGGCGC
AGGCGCGTCTTGCAGCACGTCGTGCAAAGGAAGCTGCGCGCAGAAAAAGT
GGAATGGATAGTTTTGGGTTGCCGGGAAAGTTGGCCGACTGTTCGCTCAA
GGATCCGGCGAAGTGCGAAGTATATATTGTGGAAGGGGATTCTGCAGGAG
GTTCGGCGAAAAAAGGACGGGACAGCAAGACACAGGCCATTTTGCCTTTG
TGGGGGAAGATGCTGAACGTGGAAAAGACACGTTTGGATAAGGTCTTGCA
TAACGAAAAATTACAGCCAATTATCGCAACGCTCGGTACAGGTGTTGGCA
AGGATTTTGATTTAACAAGGATTCGCTATCATAAAGTGATCATCATGGCG
GATGCGGACGTGGATGGCTCTCACATCCGTACGCTTCTTTTAACGTTCTT
CTTTCGATACCTGCCGCAAATAATTGAAGCTGGTTACGTATATCTTGCGA
TGCCGCCTTTGTATCGCATTGCGTGGAGTAAAAAGGAACTGTATGTGTAT
AGCGACACAGAGCGTGACGAAGCGCTAGAAAGTATCGGTAAAAAAAGTGG
TGTCGCTGTGCAGCGTTATAAAGGTCTGGGGGAAATGGATGGCACTCAGC
TTTGGGAGACAACTATGAATCCAGTGCGTCGCAAGATGATGCAGGTGGTG
CTCTCAGATGCGGTGGAAGCAGACCGGGTGTTTAGTACTCTCATGGGTGA
AGATGTCGAACCGCGCCGTAAGTTTATTGAAGAGAATGCAATATATGCGC
GTTTGGACGTA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy