Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Treponema pallidum Search Results

Record: 1 of 1  
MiniMap IGR735 IGR737 IGR739 IGR738 IGR740 IGR734 IGR733 IGR736 recR, - TP1004 TP1002 thy1, - TP1007 TP1001 dnaX, - TP1005 gyrB, - TP1006 TP1000 TP1003 TP0999 recR, - TP1004 TP1002 thy1, - TP1007 TP1001 dnaX, - TP1005 gyrB, - TP1006 TP1000 TP1003 TP0999 Type: tandem, Name:  - 222 recR, - TP1004 TP1002 thy1, - TP1007 TP1001 dnaX, - TP1005 gyrB, - TP1006 TP1000 TP1003 TP0999
* Calculated from Protein Sequence

Gene ID: TP1004

DNA Molecule Name:
1  

Genbank ID:
3323328

Gene Name:
recR  

Definition:
recombination protein RecR

Gene Start:
1093158

Gene Stop:
1092556

Gene Length:
603

Molecular Weight*:
21785

pI*:
6.93

Net Charge*:
-0.22

EC:
 

Functional Class:
Replication; DNA replication, restriction, modification, recombination, and repair  

Pathway: pathway table

Secondary Evidence:
Bork JM, Cox MM, Inman RB.
The RecOR proteins modulate RecA protein function at 5' ends of single-stranded DNA.
EMBO J. 2001 Dec;20(24):7313-22.
PMID: 11743007

Courcelle J, Hanawalt PC.
Participation of recombination proteins in rescue of arrested replication forks in UV-irradiated Escherichia coli need not involve recombination.
Proc Natl Acad Sci U S A. 2001 Jul;98(15):8196-202.
PMID: 11459953

Peláez AI, Ribas-Aparicio RM, Gómez A, Rodicio MR.
Structural and functional characterization of the recR gene of Streptomyces.
Mol Genet Genomics. 2001 Jun;265(4):663-72.
PMID: 11459186

Webb BL, Cox MM, Inman RB.
Recombinational DNA repair: the RecF and RecR proteins limit the extension of RecA filaments beyond single-strand DNA gaps.
Cell. 1997 Oct;91(3):347-56.
PMID: 9363943

Comment:
RecR may play a role in DNA repair. It seems to be involved in a
RecBC-independent recombinational process of DNA repair. It may act
with RecF and RecO.

Blast Summary:  PSI-Blast Search
Gapped BLAST revealed several significant hits to recombination
protein RecR. For example residues 3-196 are 47% similar to RECR_SYNY3,
recombination protein RecR of Synechocystis sp.,(D90916).

COGS Summary:  COGS Search
BeTs to 9 clades of COG0353
COG name: Recombinational DNA repair protein
Functional Class:? L
The phylogenetic pattern of COG0353 is -----q-cebrhuj---linx
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search
None.

ProDom Summary:  Protein Domain Search
Residues 3-196 are 43% similar to recombination protein of RECR_HAEIN.

Paralogs:  Local Blast Search
There is no evidence of paralogs in T. pallidum.

Pfam Summary:  Pfam Search
Residues 36 to 77 (E-value = 6.2e-17) place TP1004 in the RecR family which is described as RecR protein (PF02132)
Residues 78 to 171 (E-value = 6.1e-15) place TP1004 in the Toprim family which is described as Toprim domain (PF01751)

PDB Hit:
none

Gene Protein Sequence:
MIPAIEEVVEHLSRLPGIGVKLATRLAYHLLKRDPAEAQVLARGIACLHE
RVYRCVCCGAFCEGRTCALCTDASRDRGIICVVERAQDVEMMAGVGEYRG
LFHVLGGVIAPLEGVGPDQLRIAALLKRLQESSVREVILALNPTVEGDTT
ALYVQKILANFPVIVTRLASGIPVGGDLEYIDRTTLAHSLRGRRPLDCSE
A

Gene Nucleotide Sequence:  Sequence Viewer
ATGATACCGGCGATTGAAGAAGTAGTGGAGCATTTATCTCGTCTCCCGGG
TATTGGAGTAAAGCTGGCGACGCGCCTTGCCTATCACCTTTTGAAACGTG
ACCCCGCTGAAGCGCAGGTTCTTGCGCGCGGGATTGCGTGTTTGCATGAG
CGCGTATATCGGTGTGTGTGCTGCGGTGCTTTCTGTGAGGGGAGGACCTG
CGCGTTGTGCACGGATGCGTCTCGGGACCGAGGCATCATTTGTGTAGTGG
AGCGTGCGCAGGACGTGGAAATGATGGCGGGTGTGGGGGAGTATCGGGGT
TTATTCCACGTGTTAGGAGGAGTCATTGCACCGCTTGAGGGGGTCGGTCC
TGACCAGCTCCGTATTGCGGCGTTGCTGAAACGGTTGCAAGAGAGTTCAG
TACGGGAAGTTATTCTGGCGTTGAATCCCACCGTGGAAGGGGATACCACC
GCCTTGTATGTGCAAAAAATCCTTGCAAACTTTCCGGTAATAGTAACGCG
TCTAGCGTCTGGTATCCCCGTAGGGGGGGACTTAGAATATATCGACCGAA
CGACATTGGCGCACAGCCTGCGTGGGCGCCGGCCACTTGATTGCTCGGAG
GCT


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy