Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Treponema pallidum Search Results

Record: 1 of 1  
MiniMap IGR735 IGR737 IGR739 IGR732 IGR738 IGR734 IGR733 IGR736 recR, - TP1004 TP1002 TP1001 TP0998 dnaX, - TP1005 gyrB, - TP1006 TP1000 TP1003 TP0999 recR, - TP1004 TP1002 TP1001 TP0998 dnaX, - TP1005 gyrB, - TP1006 TP1000 TP1003 TP0999 Type: tandem, Name:  - 222 recR, - TP1004 TP1002 TP1001 TP0998 dnaX, - TP1005 gyrB, - TP1006 TP1000 TP1003 TP0999
* Calculated from Protein Sequence

Gene ID: TP1002

DNA Molecule Name:
1  

Genbank ID:
3323327

Gene Name:


Definition:
conserved hypothetical protein

Gene Start:
1091298

Gene Stop:
1090633

Gene Length:
666

Molecular Weight*:
24770

pI*:
9.64

Net Charge*:
5.82

EC:
 

Functional Class:
Conserved hypothetical  

Pathway: pathway table

Comment:


Blast Summary:  PSI-Blast Search
Gapped BLAST revealed only one significant hit in the database.
Residues 24-203 are 31% similar to B. burgdorferi predicted coding
region BB0403,(AE001145).

COGS Summary:  COGS Search
No hits to the COGs database.

Blocks Summary:  Blocks Search
None.

ProDom Summary:  Protein Domain Search
None.

Paralogs:  Local Blast Search
There is no evidence of paralogs in T. pallidum.

Pfam Summary:  Pfam Search
No significant hits to the Pfam 11.0 database

Structural Feature(s):
Feature Type  Start  Stop
gram positive/gram negative signal  
1  
18

PDB Hit:
none

Gene Protein Sequence:
MCYLAAVFLTLCTKSAMAGDIATFVNLGFSAHGKTFAFGQHGVTDGLYQA
YADIYVVDVESNRFVQGGVVRTTPTRETKGKRSMDVFLALQNRAQSLLQR
ADISALRLGRTLYVQAEDRMGEETLLFRDFKTNVEYVVVMHVERTTELGV
SFYLTVEMTRPNGSKVSRVVGQRGYVRPGVKNYALKKVLINEQQDALIFV
VEKHGYAPDGASVRYMVEACRL

Gene Nucleotide Sequence:  Sequence Viewer
GTGTGCTATCTGGCAGCGGTGTTTTTGACGTTATGTACGAAGTCTGCCAT
GGCGGGAGATATCGCGACCTTTGTGAATTTGGGATTTTCTGCGCACGGAA
AGACATTTGCCTTTGGACAGCACGGGGTAACTGATGGGTTGTATCAGGCG
TATGCGGATATCTATGTGGTGGACGTAGAATCAAACCGTTTTGTGCAGGG
AGGGGTAGTGCGCACAACGCCGACGCGAGAAACAAAAGGCAAACGAAGCA
TGGATGTCTTTCTTGCGTTGCAGAACCGCGCGCAATCTCTCTTGCAACGT
GCAGATATTTCTGCGCTGCGTTTGGGGCGTACTCTGTACGTGCAGGCTGA
GGATCGGATGGGGGAAGAGACGCTACTGTTTCGAGATTTTAAAACGAATG
TAGAATATGTGGTGGTTATGCATGTAGAACGGACAACAGAGCTGGGTGTG
TCGTTCTATTTGACGGTTGAAATGACAAGACCGAATGGAAGCAAAGTTTC
GCGTGTGGTGGGGCAGCGCGGCTATGTGCGACCGGGGGTGAAAAATTACG
CCTTAAAAAAAGTACTTATTAATGAGCAGCAGGACGCTTTGATTTTTGTT
GTTGAAAAGCACGGATATGCCCCTGATGGAGCATCAGTTCGGTACATGGT
AGAGGCGTGTCGTCTG


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy