Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Treponema pallidum Search Results

Record: 1 of 1  
MiniMap IGR735 IGR737 IGR739 IGR732 IGR738 IGR734 IGR733 IGR736 recR, - TP1004 TP1002 TP1001 TP0998 dnaX, - TP1005 gyrB, - TP1006 TP1000 TP1003 TP0999 recR, - TP1004 TP1002 TP1001 TP0998 dnaX, - TP1005 gyrB, - TP1006 TP1000 TP1003 TP0999 Type: tandem, Name:  - 222 recR, - TP1004 TP1002 TP1001 TP0998 dnaX, - TP1005 gyrB, - TP1006 TP1000 TP1003 TP0999
* Calculated from Protein Sequence

Gene ID: TP1001

DNA Molecule Name:
1  

Genbank ID:
3323334

Gene Name:


Definition:
hypothetical protein

Gene Start:
1090616

Gene Stop:
1089438

Gene Length:
1179

Molecular Weight*:
43427

pI*:
7.48

Net Charge*:
2.73

EC:
 

Functional Class:
Hypothetical  

Pathway: pathway table

Comment:


Blast Summary:  PSI-Blast Search
No hits found in gapped BLAST.

COGS Summary:  COGS Search
No hits to the COGs database.

Blocks Summary:  Blocks Search
NONE.

ProDom Summary:  Protein Domain Search
NONE.

Paralogs:  Local Blast Search
No evidence of paralogs in T.pallidum.

Pfam Summary:  Pfam Search
No significant hits to the Pfam 11.0 database

PDB Hit:
none

Gene Protein Sequence:
MQSYEGGVWLTCDIMGVSLFLVREHVVMWDLHRALCAGLLSVLLYGGCSS
ARDFVHVMKTAGNEVALVHYALQGDCIVFGFRGEVSDVVARVYRAEGVVS
EEMSDELLQSFTDEIPSALSRIAVPAAYQESVDAARERLSFFAVRFLQKP
HVGQQVVLRGSAQDVAHQKHDFVLPFEGINTQPARLEISEVRPLYGNKRS
EFVELLVVESGNLLGITITNVGGKGNRCDYHFPAAQVRVGERVVLHWRKQ
DPASCDELSAETVSAGSQACARARDFWGQERSIPGRNPNAIVVKESANGK
IQDALLFFNTHVKKGKAPTFRWAFPEIEAASRLALEQGAWLSTHEHFPLR
ESHFFQCDLTPAKSIALKRKRGAGRSAADCFVLKKATMGLPNQ

Gene Nucleotide Sequence:  Sequence Viewer
TTGCAATCGTACGAGGGTGGGGTATGGCTTACGTGTGATATAATGGGCGT
TAGCCTATTTTTGGTGAGGGAGCATGTCGTCATGTGGGATCTGCATCGTG
CTTTATGCGCAGGGTTGTTGAGTGTGCTGCTCTACGGCGGCTGTTCTTCT
GCGCGGGACTTTGTACACGTTATGAAAACTGCGGGCAATGAAGTGGCGCT
TGTGCATTACGCGTTGCAAGGTGATTGCATTGTGTTTGGTTTTCGCGGTG
AGGTATCTGATGTAGTTGCGCGCGTATATCGCGCAGAGGGTGTTGTTTCA
GAGGAAATGAGCGATGAGCTGTTGCAGTCCTTTACAGACGAAATCCCCTC
TGCACTTTCACGCATTGCGGTGCCTGCAGCGTATCAGGAGTCTGTGGATG
CAGCCCGTGAGCGCCTTTCGTTTTTCGCAGTGCGCTTTTTACAAAAGCCG
CACGTGGGGCAGCAGGTGGTATTGCGTGGTAGTGCGCAGGACGTGGCGCA
CCAGAAGCATGATTTTGTGCTTCCTTTTGAGGGGATAAATACACAGCCTG
CGCGTTTAGAAATCAGCGAAGTCCGTCCCCTTTATGGGAATAAACGCTCG
GAATTTGTGGAATTGCTTGTCGTGGAATCCGGTAATTTGCTGGGAATTAC
TATCACAAATGTAGGTGGCAAGGGGAATCGCTGCGACTATCATTTTCCTG
CAGCCCAGGTGCGGGTAGGAGAGCGTGTGGTATTACATTGGCGTAAGCAG
GATCCTGCTTCGTGTGATGAACTGTCTGCTGAAACGGTATCGGCAGGTTC
GCAGGCCTGTGCGCGTGCACGCGATTTTTGGGGGCAGGAACGCTCAATCC
CAGGGCGTAACCCAAACGCAATCGTAGTGAAAGAATCTGCCAACGGAAAG
ATACAGGATGCGCTGCTATTCTTTAATACCCACGTAAAAAAGGGAAAGGC
GCCGACGTTTCGCTGGGCTTTTCCAGAAATTGAAGCTGCCTCGCGGCTTG
CATTGGAGCAAGGGGCGTGGCTGAGCACGCACGAGCACTTCCCTCTAAGA
GAGAGTCACTTTTTTCAGTGCGATTTGACGCCAGCGAAGAGTATCGCGTT
AAAGCGCAAACGGGGCGCAGGCCGATCTGCGGCAGATTGTTTTGTGCTAA
AAAAAGCAACGATGGGGTTGCCAAATCAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy