Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Treponema pallidum Search Results

Record: 1 of 1  
MiniMap tRNA-Ala-3 IGR735 IGR731 IGR732 IGR734 IGR730 IGR733 IGR736 TP1002 TP1001 TP0998 TP0996 sppA, - TP0997 TP1000 TP1003 TP0999 TP1002 TP1001 TP0998 TP0996 sppA, - TP0997 TP1000 TP1003 TP0999 TP1002 TP1001 TP0998 TP0996 sppA, - TP0997 TP1000 TP1003 TP0999
* Calculated from Protein Sequence

Gene ID: TP0999

DNA Molecule Name:
1  

Genbank ID:
3323325

Gene Name:


Definition:
cell division protein (FtsK-related protein)

Gene Start:
1086047

Gene Stop:
1088443

Gene Length:
2397

Molecular Weight*:
86600

pI*:
5.83

Net Charge*:
-10.94

EC:
 

Functional Class:
Cellular processes; Cell division  

Pathway: pathway table

Comment:


Blast Summary:  PSI-Blast Search
Gapped BLAST revealed the middle and C-terminal region had several
significant hits to cell division proteins. For example residues
354-797 are 57% similar to the putative cell division protein of
Borrelia burgdorferi,(AE001136).

COGS Summary:  COGS Search
BeTs to 8 clades of COG1674
COG name: DNA segregation ATPase FtsK/SpoIIIE and related proteins
Functional Class:  D
The phylogenetic pattern of COG1674 is --------eBRhUJ--olinx
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search
Residues 482-497 represent significant (99%) hits to blocks PR00443A,
G-PROTEIN ALPHA SUBUNIT GROUP S SIGNATURE and PR00441A, G-PROTEIN ALPHA
SUBUNIT GROUP I SIGNATURE.

ProDom Summary:  Protein Domain Search
Residues 358-785 are 48% similar to cell division protein FtsK of
FTSK_ECOLI.

Paralogs:  Local Blast Search
There is no evidence of paralogs in T. pallidum.

Pfam Summary:  Pfam Search
Residues 443 to 636 (E-value = 8.8e-69) place TP0999 in the FtsK_SpoIIIE family which is described as FtsK/SpoIIIE family (PF01580)

Structural Feature(s):
Feature Type  Start  Stop
transmembrane  
13  
36
transmembrane  
48  
74
transmembrane  
124  
144
non-globular  
156  
331
coil-coil  
553  
584

PDB Hit:
none

Gene Protein Sequence:
MERSPLPRIIALTFGTLLFVSAVLLTLSTFLPLFTLHRASHWFFVPGTLL
YETYAFSSLLVPLLLLHTALLLFVGGRSLRAESALVAFPLLFITAVCGEH
GLYALRRALAARSISPSTRGGIDIVCVLCLLALLGAELYAALIYGERCYV
WFHARIPRDFIADGFQDPSFPPSTADHPDTVSPPPAPSCATADVQTPEAS
APPEGQFSTEVPLQGGEFLISEAEVQPATQVAACGGVSTPTALAPSVPSQ
APFPLLPAPGLIQSNLPSDVHAPASPGSLPSVIPAQAPCVMALSPISAPS
VAPAETLIPAQDDEQGPPRPIPASAAPLRHPCRGYQVPYDLLDQYSEDTY
EGIDELTKNLALLLEETFSEFNIRVEITGIKKGPVVTMFELLPPPGIKLS
KITNLQDNVALKLAASSVRIVAPIPGKHAIGVEVPNKKRSLVTFKELLHT
RTAGSNRMAIPVILGKDVTGEPQVIDLAQTPHLLIAGATGSGKSVCVNAL
ILSILYHKCPDETKLLLIDPKIVELKLYNDIAHLLTPVITEPKRALQALQ
YILCEMERRYALLEQLECRDIKTYNKKIQEKSIATQPLPFIVIIIDEFAD
LMVASGKELETSVARLCAMSRAVGIHLVLATQRPSIDVITGLIKANIPSR
IAFMVSSKMDSRIILDEMGAEKLLGRGDMLYMNPSQSFPTRIQGAYVSER
ELARVIAHVRAWGTPEYLDEEIFFDDDDASISGNFVDESDPLYEQAVQVV
QYAGKASTSYVQRKLKIGYNRAARLIEEMEARGVVGPPNGSKPRDVLRS

Gene Nucleotide Sequence:  Sequence Viewer
ATGGAACGATCCCCTTTACCTAGAATTATCGCTCTTACCTTCGGCACACT
GCTATTCGTCAGTGCAGTGCTCCTGACCCTGTCCACGTTTCTTCCCCTTT
TTACCTTGCACCGAGCATCACACTGGTTCTTCGTACCTGGCACTCTCCTT
TACGAAACGTACGCTTTCTCCTCCTTGCTCGTGCCGCTGTTACTCTTGCA
CACAGCGCTCCTCTTGTTTGTCGGCGGACGTTCGTTACGGGCAGAAAGCG
CACTTGTTGCCTTCCCACTCTTGTTCATTACTGCAGTGTGTGGAGAACAC
GGTCTCTACGCGCTACGACGCGCACTCGCTGCACGGTCAATTTCACCGTC
AACGCGGGGAGGGATAGACATCGTATGCGTCCTTTGCCTCCTCGCATTGC
TGGGAGCAGAGCTCTATGCTGCACTCATTTACGGGGAAAGGTGTTACGTA
TGGTTTCATGCACGTATCCCTCGCGATTTCATCGCTGATGGATTCCAAGA
CCCCTCCTTCCCTCCCTCCACCGCCGATCATCCTGACACCGTTTCCCCTC
CCCCCGCTCCCTCCTGCGCCACCGCAGATGTGCAGACGCCCGAAGCAAGC
GCGCCCCCAGAGGGGCAATTCTCCACGGAAGTTCCCCTCCAGGGGGGAGA
ATTTTTGATTTCTGAGGCAGAGGTGCAGCCTGCCACGCAGGTGGCAGCGT
GTGGCGGTGTGTCCACGCCAACTGCTTTGGCGCCATCGGTGCCTTCTCAG
GCTCCATTCCCCCTGCTCCCAGCGCCCGGGCTCATTCAGAGTAACCTTCC
CTCAGACGTTCACGCCCCCGCGTCACCCGGGTCTTTGCCGTCTGTCATCC
CTGCACAGGCACCGTGTGTCATGGCCCTCTCTCCTATCTCTGCTCCCTCA
GTCGCCCCCGCTGAAACCCTTATTCCTGCGCAAGACGATGAACAGGGACC
ACCGCGTCCTATTCCTGCCTCAGCAGCTCCGCTTCGGCACCCTTGCCGCG
GCTACCAAGTACCGTACGACTTGCTTGACCAGTACTCAGAGGACACATAT
GAAGGAATTGACGAGCTCACCAAGAATCTTGCACTCCTGCTTGAGGAAAC
ATTCTCTGAATTCAACATTCGAGTAGAAATCACCGGTATCAAGAAGGGTC
CTGTAGTCACAATGTTCGAGCTTCTCCCTCCACCCGGCATCAAACTGTCA
AAAATTACAAATCTGCAGGACAACGTTGCGCTCAAGCTTGCTGCTTCAAG
CGTGCGCATCGTCGCTCCCATTCCTGGAAAACACGCCATAGGCGTGGAAG
TCCCTAACAAAAAACGATCCCTCGTTACATTCAAAGAACTGCTCCATACG
CGCACAGCTGGCAGCAACCGTATGGCCATCCCTGTCATCCTTGGCAAAGA
CGTTACCGGCGAACCACAGGTTATCGACCTTGCCCAAACACCTCACCTGC
TCATTGCAGGCGCAACTGGGTCGGGTAAATCAGTATGCGTAAACGCGCTC
ATTCTCTCTATCCTGTACCACAAGTGTCCTGACGAAACCAAACTTCTGCT
CATTGATCCAAAAATCGTAGAGTTAAAGCTCTACAACGATATCGCCCACC
TTCTCACTCCTGTCATCACTGAGCCCAAAAGAGCACTCCAAGCACTACAG
TACATCCTGTGCGAAATGGAGCGACGCTATGCGCTTCTTGAGCAATTAGA
ATGCCGCGACATTAAGACCTACAACAAAAAAATACAGGAAAAAAGCATCG
CCACGCAGCCTCTCCCATTCATCGTTATTATCATTGATGAATTTGCAGAC
TTAATGGTTGCCTCTGGCAAAGAATTAGAAACGAGTGTTGCGCGTTTGTG
CGCGATGAGCCGTGCAGTAGGCATCCATTTGGTACTTGCCACCCAGCGAC
CGTCAATCGATGTCATCACCGGCCTTATTAAGGCAAATATTCCAAGCAGA
ATTGCCTTTATGGTTTCATCTAAAATGGATAGCCGTATTATTTTGGATGA
GATGGGCGCAGAAAAATTGCTGGGACGAGGGGATATGCTGTACATGAACC
CGAGTCAGTCTTTTCCTACGCGGATTCAAGGTGCGTATGTTTCCGAGCGA
GAATTAGCGCGCGTGATCGCCCATGTACGCGCGTGGGGAACGCCTGAGTA
TCTTGATGAAGAAATTTTCTTTGACGATGACGACGCGAGTATATCTGGAA
ATTTTGTGGATGAAAGCGATCCTTTATACGAGCAGGCAGTGCAGGTAGTG
CAATACGCGGGTAAAGCGTCCACATCGTATGTGCAACGTAAATTGAAGAT
AGGCTACAATCGCGCCGCGCGCCTAATCGAAGAAATGGAAGCAAGGGGGG
TGGTCGGTCCGCCGAATGGATCCAAGCCACGTGATGTTTTGCGTTCG


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy